puzzle picture
1498: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed

Summary

Name: 1498: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed
Created: 03/19/2018
Points: 100
Expired: 03/26/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,558100
2Anthropic Dreams10,50973
3Void Crushers10,50852
4Beta Folders10,45436
5L'Alliance Francophone10,41724

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1eusair 74 71  10,711100
2Enzyme 74 103 Gargleblasters10,55694
3Timo van&n... 74 5 Void Crushers10,50890
4Galaxie 2 2 Anthropic Dreams10,50487
5fiendish_ghoul 74 8  10,49584


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons