puzzle picture
1489: Revisiting Puzzle 52: Bacteria Energy
Status: Closed

Summary

Name: 1489: Revisiting Puzzle 52: Bacteria Energy
Status: Closed
Created: 02/28/2018
Points: 100
Expired: 03/07/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,864100
2Beta Folders9,84871
3Gargleblasters9,81949
4Marvin's bunch9,77833
5Void Crushers9,70522

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons