puzzle picture
1461: Revisiting Puzzle 143: Rosetta Decoy 7
Status: Closed

Summary

Name: 1461: Revisiting Puzzle 143: Rosetta Decoy 7
Status: Closed
Created: 12/19/2017
Points: 100
Expired: 12/26/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders8,927100
2Anthropic Dreams8,88873
3Go Science8,86952
4Gargleblasters8,83336
5L'Alliance Francophone8,81024

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

toshiue's picture
User is online Online
Joined: 01/31/2016
Groups: Go Science
server error on shares

Have been getting sporadic server errors when trying to DL shares on 1461. Such devolved into not showing any shares more recent than 36 hours ago. Closed all clients, rebooted machine, restarted all 1461 clients several times, tried on three different computers. Cannot read shares more recent than 36 hours ago. No one polled is saying they've had the same problem, but then none are saying they had success either. tosh

toshiue's picture
User is online Online
Joined: 01/31/2016
Groups: Go Science
server error on shares...

Scratch that, we solved...

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons