puzzle picture
1338: Unsolved De-novo Freestyle 99
Status: Closed

Summary

Name: 1338: Unsolved De-novo Freestyle 99
Status: Closed
Created: 02/07/2017
Points: 100
Expired: 02/13/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TIVLVLERTKEEDSERFEREMKRLIKENQHTRIDIDGDGTYLIVVHNGHQEEIKKVMKEMKEHFKKTTSSEIRNQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters9,424100
2Go Science9,36876
3Anthropic Dreams9,34056
4Beta Folders9,32241
5Contenders9,30129

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

toshiue's picture
User offline. Last seen 1 day 9 hours ago. Offline
Joined: 01/31/2016
Groups: Go Science
unable to download 1338

Anyone else having problems downloading this? (1338)

NinjaGreg's picture
User offline. Last seen 1 hour 33 min ago. Offline
Joined: 05/21/2010
Groups: Go Science
After update, had to download from web page

Then it showed up in the Science Puzzles list as expired ....

Joined: 12/01/2011
Groups: Go Science
After update,

1336 1337 are marked expired
1338 is missing, can be downloaded manually but is also marked expired

toshiue's picture
User offline. Last seen 1 day 9 hours ago. Offline
Joined: 01/31/2016
Groups: Go Science
1338 missing

Thanks to both, DL from the web page didn't resolve. All puzzles listed as expired, but even upon refresh, list ends at 1337.

Joined: 09/24/2012
Groups: Go Science
Sometimes missing, not always

In some client (under "expired puzzles"), I did not find 1338, in other well. I think I can find it with the former version but not with the updated version. To be verified.

toshiue's picture
User offline. Last seen 1 day 9 hours ago. Offline
Joined: 01/31/2016
Groups: Go Science
unable to download 1338

former version vs updated version. suspect the same, unfortunately noticed it (inability to locate 1338) after I'd updated all clients, haven't an old version to check it against. do you more experienced folk routinely archive former versions for just such instances as this, and if so...what's the best method for doing such? (thanks)

toshiue's picture
User offline. Last seen 1 day 9 hours ago. Offline
Joined: 01/31/2016
Groups: Go Science
Joy...

latest update just solved it. 1338 downloaded and running. thanks all for the help.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons