puzzle picture
1333: Revisiting Puzzle 86: Nematode
Status: Closed

Summary

Name: 1333: Revisiting Puzzle 86: Nematode
Status: Closed
Created: 01/25/2017
Points: 100
Expired: 02/01/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP
Categories: Design, Overall

Top Groups

RankGroupScorePoints
1Beta Folders10,316100
2Contenders10,24378
3Anthropic Dreams10,15160
4L'Alliance Francophone10,11745
5Gargleblasters10,10533

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1reefyrob 11 14 Beta Folders10,295100
2dcrwheeler 73 10  10,28298
3bertro 30 7 Beta Folders10,27496
4mimi 73 1890 Contenders10,23693
5gitwut 73 1890 Contenders10,18891


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons