Contest Info

Name: Pseudomonas aeruginosa PA4063
Type: Template
Owner: mutinus
Start Date: 02/28/16
End Date: 03/31/16
Puzzle: Freestyle Design: Variable Length
Description:

This hypothetical protein has been found to be required for P. aeruginosa to colonize human airway mucus secretions, but the function is unknown.

Sequence:
MRPLLLALVLLPFAAQAHDDHDHDHAHGSLGKHEHGVAQLNVALDGKTLELELDSPAMNLVGFEHAASTDADKAAVAKARAQLEKPLELFALPVTAGCSVASQELRSPLFGDKAPAHAHKEKAGHEHEHEHEHEHGHADIHAHYQLSCEKPELLKLLTLAEFFKRFPATQKIQVQLIGPDGQKGADLAPASAELKL


Registered Contestants

UserScoresort icon
mutinus6839

Registered Groups

Groupsort iconScore
xkcd6839





Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons