puzzle picture
1127: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed

Summary

Name: 1127: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed
Created: 08/18/2015
Points: 100
Expired: 08/25/2015 - 11:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters8,383100
2Anthropic Dreams8,38280
3Go Science8,36463
4Contenders8,36149
5Hun-Magyar Csapat8,36137

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons