Contest Info

Name: protein 3AB [Enterovirus C]
Type: Template
Owner: orangejayo1
Start Date: 03/08/15
End Date: 05/08/15
Puzzle: Freestyle Design 100

A small protein with 109 amino acids.
sequence: gplqykdlkidiktspppecindllqavdsqevrdycekkgwivnitsqvqterninramtilqavttfaavagvvyvmyklfaghqgaytglpnkkpnvptirtakvq

Registered Contestants

UserScoresort icon

Contest List
Get Started: Download
  Windows    OSX    Linux  
(10.7 or later)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Only search
Recommend Foldit
User login
Top New Users

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons