Contest Info

Name: RevDimer
Type: Template
Owner: Tanamura
Start Date: 12/04/14
End Date: 12/05/14
Puzzle: Freestyle Design: Variable Length
Description:

MAGRSGDSDEDLLKAVRLIKFLYQSNPPPNPEG T R Q A R R N R R R R W R E R Q R Q I H S I S E R I L S T Y L


Registered Contestants

UserScoresort icon
Tanamura6839





Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons