Log in to Create Template Contest

All Contests (Only Show Open Contests)

NameStatusStart DateEnd DateOwnerPlayerssort icon
565645646CLOSED06/11/1006/12/10yjh0
zzzzzzzzzCLOSED06/10/1006/11/10yjh0
Script tester 3CLOSED07/04/1007/08/11Krog0
40 segmentCLOSED07/16/1007/18/10icreatemac0
ygkas2CLOSED08/11/1008/11/11sotk0
CalzolaiCLOSED09/01/1011/08/10iRob0
my contestCLOSED09/01/1009/02/10marissa1010
xz 07 biotechnology CLOSED09/02/1012/31/10xuchenidea0
Giordano's ClassCLOSED09/09/1009/13/10cgiordano0
slitherCLOSED09/16/1012/31/13missb0
easy!!!! :o)CLOSED10/01/1012/31/13yomama0
Fold It (or else)CLOSED09/20/1009/26/10Zeff0
Fold It (or else)CLOSED09/20/1009/26/10Zeff0
AlignmentCLOSED10/02/1012/31/10sielenk0
Beta-carotene dioxygenaseCLOSED10/13/1011/05/10mbarnkob0
prueba 1xCLOSED10/22/1011/11/10rascuacho0
GFPCLOSED10/18/1010/30/10Pyrohmstr0
SEAL MYOGLOBINCLOSED10/23/1010/30/10samwitus0
Beginner Alignment puzzleCLOSED11/04/1011/11/10science.nerd0
PdB24CLOSED11/05/1002/01/11PdB240
Free Challenge for University StudentsCLOSED11/18/1012/18/10ilya.makedon0
Daddy'sCLOSED11/30/1012/25/10TheDaddyTired0
Grand master rival challengeCLOSED01/01/1112/31/11Malzarg0
Beginning Alignment PuzzleCLOSED02/04/1102/12/11ltchong0
The AS challengeCLOSED03/31/1104/17/11AgentScience0
tingleiCLOSED03/09/1103/10/11tinglei7110
Sheet Banding TrickCLOSED03/21/1104/30/11itskimo0
etrgCLOSED03/26/1112/31/14oxyi0
etrgCLOSED03/26/1112/31/14oxyi0
etrgCLOSED03/26/1112/31/14oxyi0
Beginners gameCLOSED04/11/1104/17/11Zsolesz840
khc headCLOSED04/13/1104/20/13ceventer0
The unbreakable LoopsCLOSED05/30/1109/22/11lukis0
Test2 CLOSED06/10/1106/17/11Zeljko0
m,jb ghjCLOSED06/15/1112/31/14oxyi0
anyone can join (actually)CLOSED07/05/1112/16/11madpenguin0
Atoh1 Atonal homolog 1CLOSED07/11/1108/01/11RANimick0
Laurabee's puzzleCLOSED07/13/1107/14/11laurabee0
Freestyle CompetitionCLOSED07/19/1107/26/11rattlesnake80
Alignment testCLOSED07/23/1107/24/11harvardman0
Random PuzzleCLOSED08/03/1108/04/11Mp09070
Freestyle SimpleCLOSED08/19/1108/21/14WheelerLovett0
MediumFREE STYLECLOSED08/23/1108/31/14WheelerLovett0
FreestyleCLOSED09/21/1109/29/11Stano280
BCHS 3201CLOSED09/26/1111/30/11Fotis NKS0
BCHS 3201CLOSED09/26/1111/30/11Fotis NKS0
jCLOSED09/30/1110/01/11klixovann0
contestCLOSED09/27/1112/25/11meganium2140
contestCLOSED09/27/1112/25/11meganium2140
Michael and MarcoCLOSED10/05/1110/06/11bigbanggd4100
Michael and MarcoCLOSED10/05/1110/06/11bigbanggd4100
HIV challengeCLOSED10/09/1110/30/11ofc20000
SAY HI TO ZACHCLOSED10/11/1110/31/11za-za220
ACPCLOSED10/27/1110/12/12mike r0
just do itCLOSED10/30/1112/31/11pokemon.guy0
One day challengeCLOSED11/04/1111/05/11scienceschmoo0
JJJP bmi206 foldCLOSED11/07/1111/30/11Peter20000
GTPase RasCLOSED11/25/1112/31/11O Seki To0
asfCLOSED11/27/1111/30/11JimmyFraktal0
MyoglobinCLOSED11/30/1112/23/11Ronald Wichman0
jnkljnklhjnljnljnlCLOSED12/04/1112/31/11oxyi0
SERPINB5CLOSED12/19/1112/26/11Niubilism0
BLARGCLOSED12/20/1112/21/11Chappers0
variable freestlye designCLOSED12/21/1112/31/11sum0
Freestyle DesignCLOSED12/24/1112/31/11r4m3nn00dl3s0
Can you foldit?CLOSED01/03/1204/20/12S-Man0
CCCLOSED01/05/1201/07/12obson0
testCLOSED01/12/1201/31/12gurimmer0
phospholipase A2 from mamushi snake venomCLOSED01/11/1201/26/12gurimmer0
FreedomCLOSED01/07/1201/09/12qbolt5000
begginerCLOSED01/10/1201/19/12bobbyjoejr0
Freestyle!!!CLOSED01/11/1201/12/12adele210
seal myoglobinCLOSED01/13/1201/31/12sum0
HIV proteaseCLOSED01/16/1201/17/12recondite70
HolotoxinCLOSED02/03/1202/06/12Erik.dover0
erero7 challengeCLOSED02/08/1202/29/12erero70
erero7 challengeCLOSED02/08/1202/29/12erero70
erero7 challengeCLOSED02/08/1202/29/12erero70
cyrusi's challangeCLOSED02/17/1201/01/15cyrusi0
HalorhodopsinCLOSED02/18/1202/26/12MnSOD0
MonooxygenaseCLOSED03/10/1204/30/12hansfoldit0
dont worryCLOSED03/24/1203/29/12billyhuegel0
artificial muscleCLOSED03/25/1203/31/12AkimotoYuki0
CameronCLOSED04/03/1204/04/12Cameron Baxendale0
TestCLOSED04/21/1206/14/13paulsen0
DcmBCLOSED04/18/1207/13/12shadowwalk0
Protein ContestCLOSED04/25/1212/31/12Dave Levine0
Let's go!!!!CLOSED04/28/1212/12/12wendy_rupnow0
Let's go!!!!CLOSED04/28/1212/12/12wendy_rupnow0
sampleCLOSED05/08/1205/22/12govstbiochem0
TestCLOSED06/15/1206/16/12xDust0
coolkids2 contestCLOSED07/06/1207/07/12meelock0
the testing puzzle!CLOSED07/09/1208/31/12drumpeter18yrs9yrs0
HIV proteaseCLOSED07/09/1207/31/12drumpeter18yrs9yrs0
intracellular Caspase-Modulating Chimeric Antigen ReceptorCLOSED07/17/1207/17/14starone0
ContestCLOSED07/30/1207/31/12Nicbudd770
test asdfgCLOSED07/31/1208/02/12Asbiorn0
SHELLCLOSED08/09/1208/08/13chingsong0
testCLOSED08/09/1208/09/13chingsong0
Big WinCLOSED08/14/1212/31/15alexlan0
Beat it! CLOSED08/17/1208/18/12Quinton8300
d oCLOSED08/23/1208/23/15Joanna Staite0
Varriable FreestyleCLOSED08/30/1209/30/12Dishrat0060
l2pmikeCLOSED09/24/1209/25/12OppaProteinStyleZ0
l2pmikeCLOSED09/24/1209/25/12OppaProteinStyleZ0
RodCLOSED10/08/1210/09/12Rodrigo9990
test for M-SBVfCTCLOSED10/12/1210/13/12tjbertram0
test of SmfT0743fCTCLOSED10/12/1210/13/12tjbertram0
KennyCLOSED10/26/1201/01/13kennyhill0
designCLOSED11/22/1212/31/13smart guy0
FUN! FUN!CLOSED11/17/1211/30/15alexkarate0
Freestyle Design 500CLOSED11/21/1211/22/12Daileyc0
Black Nest of doomCLOSED11/23/1212/31/12mattymoe0
GTPase RasCLOSED11/23/1212/28/12ridesisapis0
lms friendsCLOSED12/03/1212/04/12johncb30
Monkeys Rock Ham jhhh hhhhhhhhhCLOSED12/04/1212/30/12NathanGotSkills230
bioinformatic task for examCLOSED12/09/1212/20/12margo3110
bioinformatic task for examCLOSED12/09/1212/20/12margo3110
100 amino acidsCLOSED12/09/1212/20/12margo3110
Easy ContestCLOSED12/12/1212/30/12haywick0
DR.B JWU BIOCHEMCLOSED12/19/1202/10/13drmbudziszek0
evaesionCLOSED12/28/1212/31/12Evaesion0
Testing Group ContestsCLOSED01/09/1301/10/13auntdeen0
Mad hatterCLOSED01/17/1301/18/13EmperorSupreme0
LASA OctagonCLOSED02/07/1302/10/13JosephOleniczak0
Bio chem assignmentCLOSED02/16/1302/15/14sonneys0
HansDampfCLOSED02/28/1305/03/13Wilm0
EL3 #2CLOSED03/01/1305/03/13Wilm0
HIV proteaseCLOSED03/05/1303/26/13alex8090100
HBV core proteinCLOSED03/14/1303/15/13Tsogo0
A Battle in DesignCLOSED03/14/1303/14/14TheEnderCavalier0
ContestCLOSED03/16/1303/31/13dallinac0
ricgtestCLOSED03/18/1303/24/13RicGray0
The Fountain of YouthCLOSED03/20/1303/31/16deinfrank0
Test 2CLOSED03/25/1304/30/13RicGray0
Biotech WFB HIVCLOSED03/28/1304/09/13KBrown0
Freestyle Design 80CLOSED04/13/1304/20/13JamesLeCornu0
the great vacation raceoffCLOSED06/01/1309/30/13shadow3450
GTPase RasCLOSED05/15/1305/31/13Ninty90
ScienceTeacherTrestingCLOSED06/04/1306/18/13ReinhardtScience0
CASPtrainingCLOSED06/10/1306/30/13Linux_Penguin0
Highest scoreCLOSED07/07/1312/25/13dbuske0
supCLOSED07/09/1307/10/13bionano10
De-Extinction!CLOSED07/10/1307/31/13gordon_wade0
UNC SHARP Contest 2CLOSED07/12/1307/31/13Sharp30
TestCLOSED07/28/1307/31/13violinist670
testcol4a3bpCLOSED07/18/1312/19/13G_H_B0
indoor soccer shoes adidas f50CLOSED07/24/1307/26/13Clarisonic1230
i-motif DNA structureCLOSED08/01/1308/31/13csjonline0
HIV ProteaseCLOSED09/01/1309/28/13Gamerrr1110
McCallie AP BiologyCLOSED09/07/1309/11/13mccallieapbiology0
HIVCLOSED09/15/1309/29/13trueplayer0
battle royalCLOSED09/17/1309/19/13delay0
yahyaCLOSED09/17/1301/13/16yahyamohammed0
ella introductionCLOSED09/28/1310/28/13manasa0
zekromCLOSED09/30/1301/01/14canadajan0
dan shit CLOSED10/05/1310/06/13nosleevesforlife0
easyCLOSED10/09/1310/31/16alex900
Come and PlayCLOSED10/31/1310/22/16roxyroxy0
Private ContestCLOSED10/21/1310/23/13theOMGmonster0
progesterone reductaseCLOSED10/25/1310/25/14sarahoconnor0
DAYDER VIRTUALIZATIONCLOSED10/30/1310/20/14Roman Rozin0
My first contest))CLOSED11/01/1311/07/13krytoy10
GTPase RasCLOSED11/10/1311/10/14MyFines0
Whatever You WantCLOSED12/20/1312/21/13The Super Cat0
owenCLOSED01/13/1401/20/14owen9o9300
missing side chainsCLOSED01/24/1402/23/14apoma0
Golden GooseCLOSED01/29/1401/30/14Maverik_Goose0
test arla 3CLOSED02/07/1402/14/14arlap0
TestCLOSED03/03/1403/13/14PeerPride0
Seal MyoglobinCLOSED03/03/1403/09/14PeerPride0
drimCLOSED03/05/1403/06/14emulhall0
Freestyle Symmetric Design: 40 DimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 40 TrimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 80 DimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 80 TrimerCLOSED04/04/1404/11/14test_account10
AmazingCLOSED05/13/1405/18/14Botanix0
test test 12345CLOSED06/04/1406/05/14Seth Cooper0
frezaeCLOSED07/18/1408/31/14frezae0
20 amino acid-- proteinCLOSED08/06/1408/24/14Barbaramoshi0
Immunoglobulin D Hinge H1CLOSED08/06/1408/17/14frogzorz0
Freestyle design 40 pcCLOSED08/17/1409/17/14Serraglio0
thiinngyyy catholeCLOSED08/19/1408/31/14aguy770
Stefano FuschettoCLOSED09/30/1407/22/16Stefano Fuschetto0
show your proteinCLOSED10/10/1410/30/14Hydromaker1070
New_contestCLOSED11/07/1412/09/14pedrofong0
test testCLOSED11/08/1411/30/14obiwan0
test testCLOSED11/10/1411/30/14obiwan0
Best DesignCLOSED11/09/1411/30/14David_M12310
Test Post Please IgnoreCLOSED11/24/1411/25/14rjking010
SH3PX1CLOSED11/25/1402/28/15Patrick11160
SH3PX1CLOSED11/25/1402/28/15Patrick11160
SH3PX1CLOSED11/25/1402/28/15Patrick11160
SH3PX1CLOSED11/25/1402/28/15Patrick11160
HIV protease contestCLOSED12/04/1412/07/14DrewNyeTheScienceGuy0
I Dare You!!!CLOSED01/09/1501/10/15nakul_07020
Come at me BroCLOSED01/08/1501/12/15GentlestElm290
Make a Greek KeyCLOSED01/27/1502/10/15jakelmer0
Fold It League Preseason ScrimmageCLOSED02/06/1502/14/15DGOVIL0
Greek Key Test RunCLOSED02/11/1503/11/15kirkngrant0
TestacularCLOSED02/22/1503/30/15HerobrinesArmy0
HbA1 TestCLOSED03/11/1503/12/15minecraft4ever40
G-quadruplexCLOSED03/14/1503/02/16kapick840
SeymoueCLOSED03/16/1503/19/15ChAda20150
D&A MessCLOSED04/28/1507/12/15ChrisScientist0
Test autoCLOSED04/11/1504/12/15wudoo0
HelixCLOSED05/13/1505/15/15dendixon0
test 1111CLOSED05/15/1512/31/15cyj1013660
bioinf02CLOSED06/06/1506/10/1523RPE0
Folding conCLOSED06/16/1506/16/16zedOFF0
GTPase Ras FoldCLOSED06/25/1507/01/15BlockheadXX0
freestyleCLOSED07/11/1509/30/15felix19980
InsulinCLOSED07/14/1507/18/15Unwise0
Peptides to designCLOSED07/26/1501/01/16Brabrax0
46 KrisCLOSED07/31/1508/07/15kristoferkeiser0
For ScienceCLOSED08/07/1509/30/15HDRH0
Design 200CLOSED09/13/1509/30/15TheFlagellum0
STDOPEN10/01/1512/31/18Smellis0
GCN-4 BipyCLOSED10/14/1510/16/15LiamMarshall0
AP BIO Pd. 3CLOSED10/28/1511/03/15smuheisen10
outer envelope protein 80 [Arabidopsis thaliana]CLOSED11/12/1501/05/16swimbug20140
TestCLOSED11/23/1511/24/15crostomily0
win or loseCLOSED11/28/1512/01/15spider8760
testCLOSED12/02/1512/03/15seantan0
Swaggy FoldingCLOSED12/10/1512/15/15Atsnider0
CLASS CONTESTCLOSED02/29/1603/31/16Herojohn170
Contest nameCLOSED03/03/1603/04/16Kristian Rodman0
sgnerCLOSED04/07/1604/08/16sgner0
Fold it!CLOSED04/19/1606/19/16krzysztofbulenger0
Freestyle RRM CLOSED04/22/1611/29/16obiwan0
Freestyle RRM CLOSED04/22/1611/29/16obiwan0
ZiaCLOSED05/17/1608/27/16Ziauddin Ahmer0
Protein StabilityCLOSED05/31/1612/31/16Alisa Southerncross0
GTPaseCLOSED06/02/1609/15/16yjguo_100
ARSBCLOSED06/10/1607/29/16szeitler180
biyokimya_2016_1CLOSED10/19/1610/23/16biyokimya_2016_ismailhoca0
Raid 3CLOSED10/21/1610/22/16TheEnderCavalier0
Biochem 124CLOSED11/12/1611/13/16John Carlo dela Cruz0
Fold like the wind (blow me away)CLOSED12/11/1612/31/16kath26560
SK IVCLOSED12/29/1612/31/15ScratchKid0
1v Foldit-1 F2017CLOSED01/05/1701/18/17kipasceu0
HIV PROTEASECLOSED01/18/1702/01/17gu140010
AELCLOSED02/14/1702/15/17JaeYeong0
Dave's challenge of despairCLOSED02/23/1702/24/17bsdn0
yuqianhengyuanCLOSED06/26/1706/27/17yuqianhengyuan0
Testing CLOSED08/23/1709/21/17Dr.Chi0
the fun alotCLOSED08/28/1708/29/17randcvn0
1V1 ME UNLESS UR SCAREDCLOSED10/19/1710/21/17I dom1nate0
bend itCLOSED10/25/1711/05/17Marlfox30
Block 11CLOSED11/16/1711/26/17drigginar0
CoolCLOSED12/02/1701/01/18BaiYang0
New City Science CLOSED12/09/1712/10/17caitlin@newcitycharterschool.org0
ycgECLOSED12/08/1712/11/17cjkunze10
NCCS weeaboosCLOSED12/07/1712/08/17sushiboi0
NCCS weeaboosCLOSED12/07/1712/08/17sushiboi0
A Test Custom ContestCLOSED12/29/1712/31/17Seth Cooper0
A Test Custom Contest 2 - fold.itCLOSED12/29/1712/31/17Seth Cooper0
asdfCLOSED01/09/1801/31/18Seth Cooper0
PM_1CLOSED01/17/1801/27/18PM_KSienkiewicz0
Ali GCLOSED01/22/1801/29/18JonnyT0
pranavCLOSED01/28/1801/29/18pranavchels0
pranavtestCLOSED03/15/1803/16/18pranavchels0
2002949_0000 testCLOSED03/22/1803/31/18Seth Cooper0
test17CLOSED04/03/1804/04/18horowsah0
test18CLOSED04/03/1804/04/18horowsah0
testCLOSED04/07/1804/08/18samicheen0
test20CLOSED04/11/1804/12/18horowsah0
abcCLOSED04/14/1804/15/18samicheen0
test descriptionCLOSED04/16/1804/17/18samicheen0
test31CLOSED04/18/1804/19/18horowsah0
test titleCLOSED04/20/1804/27/18Seth Cooper0
test35CLOSED05/03/1805/04/18horowsah0
contest_node_form contest_node_formCLOSED05/10/1805/13/18customposter0
template contest test 2CLOSED05/07/1805/14/18Seth Cooper0
custom contest test 2CLOSED05/07/1805/14/18Seth Cooper0
template contest test 3CLOSED05/07/1805/14/18Seth Cooper0
custom contest test 3CLOSED05/07/1805/14/18Seth Cooper0
test templateCLOSED05/04/1805/05/18samicheen0
Custom Contest 1CLOSED05/08/1805/10/18customposter0
another testCLOSED05/17/1805/19/18josh030
test puzzle uncheckCLOSED05/24/1805/25/18samicheen0
testCLOSED05/29/1805/30/18joshmiller0
testOPEN06/22/1807/16/18Bruno Kestemont0
protein to test scriptsCLOSED05/22/1012/31/10smith92clone1
test testCLOSED05/29/1005/30/10CharlieFortsConscience1
Script tester - DesignCLOSED01/01/3005/24/13Krog1
Beginner puzzle copyCLOSED05/31/1005/18/12Krog1
Even simpler recipe testerCLOSED05/31/1006/30/10Datstandin1
20 seg script testCLOSED06/05/1012/31/10srssmith921
aendgraend tested contestsCLOSED06/09/1006/13/10aendgraend1
assasaCLOSED06/10/1006/11/10yjh1
The Beginner contestCLOSED06/24/1006/30/10Gebauer1
Test areaCLOSED06/24/1012/31/10mat7471
Test area - HIV proteaseCLOSED06/24/1012/31/10mat7471
Freestyle 80 for a monthCLOSED06/25/1007/31/10sehskyle1
Script tester 2CLOSED07/04/1007/05/12Krog1
Script tester 3CLOSED07/04/1007/08/11Krog1
MCLOSED07/05/1007/31/13RoboMonkey1
asdfadfCLOSED07/05/1007/29/10RoboMonkey1
aCLOSED07/11/1007/25/10asianboy261
80segmentCLOSED07/12/1007/31/10asianboy261
a.lCLOSED07/13/1007/15/10asianboy261
hiv proteaseCLOSED07/11/1007/17/10asianboy261
GTPaseCLOSED07/11/1008/31/10Jordandk1
math modelingCLOSED07/16/1007/29/12themarquis1
Contest name goes here?CLOSED08/02/1008/05/10oakwhiz1
Phalpha1betaCLOSED08/14/1008/15/10mvackel1
CD44 proteinCLOSED08/14/1008/24/10mikedressner1
The science is pure scienceCLOSED08/15/1008/21/10Dj-P1
GTPase RasCLOSED08/18/1008/31/10cyclic31
1CLOSED08/19/1008/31/10lipasesucks1
12CLOSED08/19/1008/31/10lipasesucks1
testCLOSED08/19/1008/20/10beta_helix1
HiV tryCLOSED08/20/1009/20/10Pyotr1
TestCLOSED08/21/1008/23/10Acida-21
Freestyle Design 80CLOSED08/21/1010/31/10Handful1
motor protein tailCLOSED08/23/1008/23/11ceventer1
ygkas 1-80CLOSED08/23/1008/23/11sotk1
ygkas1 40-120CLOSED08/26/1008/26/11sotk1
Target 611 - TestCLOSED08/29/1008/30/10Cyanoia1
BattleGrounds....v.5655.88CLOSED08/31/1008/24/13InsaneGamer14571
Loss CancerCLOSED08/31/1012/31/10FalconDeOro1
Aids SecurityCLOSED09/02/1001/22/11Gaara1
Test Range- HIV LabCLOSED09/01/1009/05/10buddy10181
bonebreakeCLOSED09/09/1009/17/10baeda1
BP's 611CLOSED09/10/1009/11/10Bletchley Park1
PhAlpha1BetaCLOSED09/12/1009/13/10mvackel1
PhAlpha1BetaCLOSED09/12/1009/15/10mvackel1
Contest10000G1CLOSED09/14/1010/01/10crispy fry1
best scoreCLOSED09/17/1009/21/10Willbee1
testCLOSED09/19/1009/20/10rangerQ1
Long ContestCLOSED09/20/1001/01/12maquiladora1
free style 500CLOSED09/20/1010/31/10ethanIc1
Script Test IVCLOSED09/21/1001/31/11Crashguard3031
mva1alphaCLOSED09/22/1009/21/11mvackel1
Superkittyhorse proteinsCLOSED09/27/1012/31/10avapenny1
Need structureCLOSED09/29/1010/10/10canikickit491
AlignmentCLOSED10/02/1012/31/10sielenk1
AATG TK BioteknologiCLOSED10/04/1010/08/10thomas.holm@gmail.com1
random testCLOSED10/12/1012/31/10Ryanfav1
kanyaCLOSED10/14/1010/26/10g53144016731
khc testCLOSED10/14/1010/14/11ceventer1
TestCLOSED10/15/1010/16/10Pyrohmstr1
TestCLOSED10/15/1010/23/10Pyrohmstr1
Freestyle Design 80CLOSED10/17/1010/01/11BlueRabit1
mehCLOSED10/17/1010/31/10anthunk1
GFPCLOSED10/18/1010/30/10Pyrohmstr1
GFP1CLOSED10/18/1010/30/10Pyrohmstr1
P1a1bCLOSED10/22/1010/21/11mvackel1
niepCLOSED10/24/1010/26/10niep03291
CASP9 Target 611CLOSED10/24/1011/30/10cd111
testCLOSED10/25/1010/31/13centic1
XYCLOSED10/28/1010/29/10PdB241
PdB24CLOSED11/05/1002/01/11PdB241
AlabudzkiCLOSED11/06/1012/31/10alabudzki1
MRMAND123CLOSED11/09/1111/09/12MR MAN D1
hardCLOSED11/13/1012/31/10marshin1
hivCLOSED11/12/1001/16/11marshin1
hotuCLOSED11/12/1011/30/10marshin1
SKHJGFDRSKLCLOSED11/12/1011/30/10marshin1
Design a proteinCLOSED11/18/1012/18/10svenskhan1
seal myoglobinCLOSED12/01/1012/01/12traywright1
Sandbox-40CLOSED12/01/1012/02/10kevinjh1
Unl. SandboxCLOSED12/02/1012/31/10kevinjh1
BiChE Easy puzzleCLOSED12/08/1012/10/10ejf3c1
AIDSCLOSED12/08/1012/31/11colonelpaco1
Freestyle Design 500CLOSED12/09/1012/12/10MHannigan1
FunCLOSED12/12/1012/31/10bost291
Large Protein TestCLOSED12/14/1012/15/10Gray Thomas1
Pedobacter Beta BarrelCLOSED12/14/1012/25/10Gray Thomas1
??CLOSED12/20/1001/01/11reedbc1
HIV Crash testCLOSED12/21/1012/31/11Dr Tyrell1
Freestyle Multi-start 499.9CLOSED12/22/1001/01/11Dj-P1
AT TestingCLOSED12/22/1012/26/10anthunk1
FreestyleBKGCLOSED12/22/1012/31/13aricc1
AT Testing TooCLOSED12/22/1012/26/10anthunk1
CHEM 1460 PuzzleCLOSED02/04/1102/12/11ltchong1
CHEM 1460 Puzzle 2CLOSED02/04/1102/11/11ltchong1
FOLD ChampionshipCLOSED12/23/1012/31/10Dj-P1
GTPase Ras 1.0CLOSED12/23/1012/31/10Dj-P1
HIV proteaseCLOSED01/02/1101/01/12maksimlekler1
Beginner Alignment PuzzleCLOSED01/02/1101/01/12maksimlekler1
CASP training puzzleCLOSED01/02/1101/01/12maksimlekler1
CASP9 Target 611 residue proteinCLOSED01/02/1101/01/12maksimlekler1
CASP9 target Design? CLOSED01/02/1101/01/12maksimlekler1
SEAL MYOGLOBINCLOSED01/02/1101/01/12maksimlekler1
Contest Template Test CLOSED01/02/1101/01/12maksimlekler1
BlankCLOSED01/04/1112/31/11kevinjh1
LUA testCLOSED01/05/1101/30/11Dj-P1
testCLOSED01/05/1101/06/11omelet bob1
testCLOSED01/05/1101/06/11omelet bob1
TestCLOSED01/06/1101/13/11Roedl1
ThreadingCLOSED01/06/1101/13/11AmyLia3301
Halobacterium NRC-1 Hypothetical ProteinCLOSED01/08/1105/31/11pramodbhat1
Pass the ThymeCLOSED01/09/1102/28/11TheGUmmer1
HIV proteaseCLOSED01/09/1112/31/14Alegend451
Freestyle Design Variable LengthCLOSED01/09/1101/01/12ten040319771
mine sillyCLOSED01/17/1112/31/11anthunk1
LaccaseCLOSED01/19/1101/23/11El_Crazy_Xabi1
Black box42CLOSED02/09/1102/11/11DaVinci211
binding motif testCLOSED02/16/1102/03/12ceventer1
Dj-P's duel puzzleCLOSED02/17/1102/18/11Dj-P1
god berryCLOSED02/18/1103/12/11My Cranky Panda1
firstCLOSED02/20/1112/31/11jojotastic7771
Truncated human ryanodine receptor 2CLOSED02/21/1105/31/11Fnallerdaller1
Truncated Human Ryanodine Receptor 2 v2CLOSED02/22/1105/29/11Fnallerdaller1
firstCLOSED02/25/1112/31/11alex20111
CASP9 targed Design test, all welcomeCLOSED03/01/1107/01/11tyler09111
bugsterCLOSED03/05/1104/30/11alex20111
Pregnancy Associated Plasma Protein (PAPP-A)CLOSED03/12/1108/15/11meschruhms1
CRAZYCLOSED03/12/1103/17/11alex20111
contestCLOSED03/19/1105/22/11protein1231
lv.1 CLOSED03/28/1104/03/11Marco Chan1
kk's contestCLOSED04/20/1104/30/11kkwizard1011
Freestyle Design: Variable LengthCLOSED04/28/1105/31/11Acida-21
SEAL MYOGLOBIN CLOSED04/28/1105/31/11Acida-21
more testingCLOSED05/04/1112/31/14anthunk1
Easy first alignmentCLOSED05/09/1105/31/11serico71
Ykl071w Amino acid sequenceCLOSED05/09/1105/31/11Dendroid1
vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyhCLOSED05/18/1105/19/11oxyi1
dhtrjkg vbuibmjjmknv n bogf bjh mknknbCLOSED05/18/1105/19/11oxyi1
dhtrjkg vbuibmjjmknv n bogf bjh mknknCLOSED05/18/1105/19/14oxyi1
dhtrjkg vbuibmjjmknv n bogf bjh mknknCLOSED05/18/1105/19/14oxyi1
576iCLOSED05/21/1112/31/14oxyi1
fbdfnbdgnCLOSED05/23/1112/31/14oxyi1
test 2OPEN05/24/1112/31/29gurch1
HIV protease contest!CLOSED05/29/1105/31/11chouti1
TestCLOSED06/04/1106/11/11Zeljko1
HIV attackCLOSED06/05/1106/30/12Overlord131
m,jb ghjCLOSED06/15/1112/31/14oxyi1
hnvfcfhncfh kbkkkhCLOSED06/15/1112/31/14oxyi1
Freestyle Design - 20 (ST - Recipe Research Channel)CLOSED06/18/1106/30/11Seagat20111
Freestyle Design CompetitionCLOSED06/20/1106/30/11Dinoclor1
any one can join tooCLOSED06/26/1109/01/11plh1
vghubzysd rxCLOSED07/31/1112/31/13oxyi1
TestCLOSED07/15/1107/01/12berus1
Test2CLOSED07/15/1107/17/11berus1
FreebuildCLOSED07/18/1107/20/11e-wok4561
freebuild2CLOSED07/18/1107/20/11e-wok4561
Let's have fun.CLOSED07/25/1108/02/11etety331
Mr Ma No.1CLOSED07/27/1107/31/12mayumiao1
To have funCLOSED07/29/1107/20/14mayumiao1
Mr Ma No. OneCLOSED07/29/1107/29/14mayumiao1
Random PuzzleCLOSED08/03/1108/04/11Mp09071
430CLOSED08/03/1108/04/11laurabee1
PODXLCLOSED08/04/1108/26/11machoo1
Freestyle SimpleCLOSED08/19/1108/21/14WheelerLovett1
laura testCLOSED08/23/1108/24/11laurabee1
laura test2CLOSED08/23/1108/24/11laurabee1
MediumFREE STYLECLOSED08/23/1108/31/14WheelerLovett1
GTPase RasCLOSED09/10/1109/01/12glenwayguy1
VopXCLOSED09/20/1110/20/11rabidfurball1
my contestCLOSED09/20/1112/20/11Lysergic cure1
Dengue Virus NS3 protease domainCLOSED09/26/1110/31/11Neffets1
arabic groupCLOSED09/22/1109/22/14ahmed magdy1
ajCLOSED09/23/1109/24/11ilikeike1
CURE CANCER win CLOSED09/24/1109/25/12Ross31
Facile for Italian :)CLOSED09/24/1110/24/11Vaio1
Multi-histidine and Glutamate sequence complexed with Mn(II)CLOSED09/26/1110/10/11masspeana1
HIV protease newCLOSED09/29/1110/31/11davidpat1
test00CLOSED09/29/1109/30/11spacevet1
test071CLOSED10/07/1110/09/11b3au0711
efeliCLOSED10/11/1110/12/11chatask1
ClpBCLOSED10/09/1110/28/12kevinjh1
Short BlankCLOSED10/10/1110/31/12kevinjh1
SandboxCLOSED10/10/1110/31/12kevinjh1
testCLOSED10/12/1110/13/11laurenting1
BMI 206 test contest - proteaseCLOSED10/12/1110/13/11amelie.stein1
BMI 206 test contest - RasCLOSED10/12/1110/14/11amelie.stein1
Freestyle Design 500CLOSED10/16/1111/06/11ofc20001
HIV proteaseCLOSED10/17/1110/22/11Joshua Algode1
GTPase RasCLOSED10/19/1103/18/12wangyueyun1
hiv proteaseCLOSED10/19/1110/19/12jerrywhite131
casp trainingCLOSED10/20/1110/31/11vk19821
first contestCLOSED10/20/1110/21/11Robinso1
My first contestCLOSED10/26/1110/31/11awesome41321
ACPCLOSED10/27/1110/12/12mike r1
ofc2000's tough challenge (open)CLOSED10/29/1110/31/11ofc20001
One day challengeCLOSED11/04/1111/05/11scienceschmoo1
Dog tests himselfCLOSED11/07/1111/08/11est000dog1
PA1955_RepeatCLOSED11/10/1112/23/11MadsTS1
hemoglobin checkCLOSED11/26/1111/30/11Rellis1
Seal MyoglobinCLOSED11/26/1111/29/11Lelivret1
aCLOSED11/27/1112/19/11JimmyFraktal1
Test_steveBCLOSED12/01/1112/08/11steveB1
Governors Academy Freestylin'CLOSED12/02/1112/04/11conorodea1111
jnkljnklhjnljnljnlCLOSED12/04/1112/31/11oxyi1
Beginner Alignment PuzzleCLOSED12/06/1112/31/11kitek314_pl1
Cancer PuzzleCLOSED12/11/1112/25/11EzraThexton1
Test PuzzleCLOSED12/18/1112/19/11kurenan1
Montcrest for realCLOSED12/20/1101/31/12Chappers1
MontcrestCLOSED12/20/1101/31/12Chappers1
hjjjjjjjjjjjjjjjjjjCLOSED12/20/1112/31/14oxyi1
my freestyle trialCLOSED12/20/1112/27/11Niubilism1
Small partial Tspan peptideCLOSED12/21/1112/31/11rwarn1
variable freestlye designCLOSED12/21/1112/31/11sum1
jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujujuCLOSED12/24/1112/31/14oxyi1
Quick & Dirty KnotFindCLOSED12/25/1101/03/12Vincero1
Test ProteinCLOSED12/26/1103/31/12kurenan1
vroomCLOSED01/02/1201/28/12kasmol1
testCLOSED01/12/1201/31/12gurimmer1
Test testCLOSED01/06/1201/13/12smfuchs1
Can you win?CLOSED01/06/1201/07/12thekidsglenn71
HIVCLOSED01/07/1202/11/12fallenspartan1
provaCLOSED01/08/1201/17/12hu74go1
FANTASYCLOSED01/09/1201/10/12hu74go1
seal myoglobinCLOSED01/13/1201/31/12sum1
Degradation of Wood! Lets understand methane and CO2 production!CLOSED01/21/1209/30/12losWEEDos1
Hexaguin's Freestyle 80CLOSED01/22/1201/31/12hexaguin1
myoglobinCLOSED01/22/1201/26/12vacmar1
HIV proteaseCLOSED01/25/1201/31/12docfon1
Bioc_670_2CLOSED01/26/1202/10/12bkuhlman1
Bioc_670_ProteaseCLOSED01/26/1202/10/12bkuhlman1
Just For FunCLOSED01/26/1201/27/12Metadryad1
RandomCLOSED01/28/1201/31/12dabanks1
Trying something out :) pardonCLOSED01/31/1202/29/12PeptideMuncher1
TheoredoxinCLOSED01/31/1201/31/14PeptideMuncher1
TestdudetestCLOSED01/31/1202/29/12testdudetest1
CRACCLOSED01/31/1202/23/12testdudetest1
Freestyle Design 80CLOSED01/31/1202/09/12kimdn1
test-contestCLOSED02/01/1202/02/12climax1411
chemchem111CLOSED02/01/1202/02/12nlite5101
leukaemia virus chain native matrixCLOSED02/01/1208/27/12GoshaDole1
Sandbox1CLOSED02/03/1202/29/12nlite5101
Sim-based Lifecycle EngineeringCLOSED02/29/1203/31/12mxynidis1
Bio 152ECCLOSED02/06/1202/16/12smfuchs1
Freestyle Design: Variable LengthCLOSED05/02/1305/10/13ligandfinder1
BIo152 ECCLOSED02/07/1202/16/12smfuchs1
erero7 challengeCLOSED02/08/1202/29/12erero71
design your own proteinCLOSED02/13/1202/14/14mberna001
khfchlk 1CLOSED02/23/1202/24/12Solenopsis invicta1
CLEAN ME!!!!!!!!!!!!!!!!!CLOSED02/17/1202/18/12Bjamin1
hiCLOSED02/17/1202/29/12cyrusi1
hi2CLOSED02/18/1203/01/12cyrusi1
CASP TrainingCLOSED02/18/1204/30/12nealk1
C21ECLCLOSED02/21/1202/25/12lijiahua19841
C21ECL-1CLOSED02/21/1202/24/12lijiahua19841
Test contestCLOSED02/23/1202/23/13f1pokerspeed1
Test2CLOSED02/23/1202/23/139ct291
GTPase Ras testCLOSED02/29/1204/30/12oshirikajirimushi18th1
HIV protease testCLOSED03/01/1205/01/12oshirikajirimushi18th1
Tspan peptide 2CLOSED03/03/1204/01/12rwarn1
HIV ProteaseCLOSED03/05/1203/01/13dbuske1
Bioc WSC ECCLOSED03/06/1203/07/12jcnichols1
testCLOSED03/11/1203/12/12RedVenom1
Yu's lab C2E1CLOSED03/11/1203/01/15lijiahua19841
Just playing aroundCLOSED03/13/1203/20/12wdherndon1
testCLOSED03/13/1203/20/12mk181
For my studentsCLOSED03/16/1203/23/12GirichMS1
blablaCLOSED03/17/1203/24/12ccilia1
Freestyle 20CLOSED03/17/1203/20/12upquark1
For studentsCLOSED03/18/1204/30/12GirichMS1
For stud. 2CLOSED03/18/1204/30/12GirichMS1
For stud. 3CLOSED03/18/1204/30/12GirichMS1
This freestyle puzzleCLOSED03/18/1204/30/12GirichMS1
No. 4.CLOSED03/18/1204/30/12GirichMS1
No. 5CLOSED03/18/1204/30/12GirichMS1
No. 6CLOSED03/18/1204/30/12GirichMS1
Mat testCLOSED03/20/1203/20/13mat7471
first timeCLOSED03/24/1203/25/12billyhuegel1
good luckCLOSED03/24/1203/25/12billyhuegel1
Cancer Treatment ContestCLOSED03/24/1204/24/12DaVinci211
Freestyle Design 80CLOSED03/24/1209/30/12ofc20001
clamp testCLOSED03/30/1203/31/12hilaryar1
CameronCLOSED04/03/1204/04/12Cameron Baxendale1
Acyl HydrolaseCLOSED04/03/1204/04/12MichaelGasse1
Foamy Virus Gag proteinCLOSED04/10/1204/17/12blutjoghurt1
BioClassCLOSED04/11/1204/15/12sarahod231
Human Respiratory Syncytial Virus Attachment Protein (RSV G)CLOSED04/12/1207/31/12MiCu1
HIV testCLOSED04/11/1204/13/12SciShowFTW1
Go freestyle!CLOSED04/15/1204/22/12AsDawnBreaks1
PFV GagCLOSED04/17/1207/17/12blutjoghurt1
Freestyle DesignCLOSED04/22/1204/30/14michaeled3141
40 Segment ChainCLOSED04/22/1204/30/14michaeled3141
Tiroler Nacht der ForschungCLOSED04/25/1204/29/12obiwan1
Tiroler Nacht der Forschung 2CLOSED04/25/1204/29/12obiwan1
Blarghs contestCLOSED04/30/1212/31/12blargh1231
LPDF ContestCLOSED04/30/1205/03/12maxionwimps1
GOVST BIOCHEMISTRYCLOSED05/07/1212/17/12govstbiochem1
rc013CLOSED05/09/1205/31/12jlmaccal1
HIV stinks.... yeah yeahCLOSED05/12/1205/01/14tweak641
MarcusCLOSED05/17/1205/20/12mdaquino1
test testCLOSED05/19/1205/20/12Stolaf1
AelCLOSED05/20/1206/03/12Aralys1
KnotsCLOSED05/22/1205/23/12AsDawnBreaks1
13-mer toxic peptidesCLOSED05/23/1205/31/12hanhnguyen141
Serine Proline Rich AfCNACLOSED05/25/1206/28/12cookie20041
Wolfer's Class 2CLOSED05/31/1206/06/12NTWII1
Test field 1CLOSED06/01/1206/02/12phi161
Transmembrane Molecule ModellingCLOSED06/01/1206/30/12Beerwing1
N-GlnRCLOSED06/09/1209/30/12weihuachen52111
SarNorACLOSED06/12/1207/12/12docsaro1
Test ProteinCLOSED06/12/1206/12/13kurenan1
KumamolisinCLOSED06/13/1207/31/15drummerdude2041
Trm7CLOSED06/14/1206/21/12v0lfg0ng1
Design itCLOSED06/15/1206/21/14DustWitch1
Freestyle Design 40: For Learning LUACLOSED06/24/1206/30/15gitwut.lua1
coolkids2 contestCLOSED07/06/1207/07/12meelock1
Just 4 funCLOSED07/12/1207/20/12Josephdud661
bioconCLOSED07/26/1207/27/12aurabum1
extended_design_tjCLOSED08/02/1208/05/12TJBrunette1
Beginner HIV proteaseCLOSED08/07/1208/10/12rarkenin1
FreestyleCLOSED08/16/1208/30/12Mytherus1
zhustbCLOSED08/26/1208/25/13chingsong1
virusCLOSED09/02/1212/28/12Aqua8171
Just for testCLOSED09/06/1209/07/12dyh1
the proteinCLOSED09/07/1209/26/15river123451
working in a mutate scriptCLOSED09/07/1209/01/13BitSpawn1
My first contestCLOSED09/14/1209/30/12SOARcdur1
GTPase pas puzzleCLOSED09/14/1212/31/12SOARcdur1
you betta winCLOSED09/19/1209/23/12SOARcmoo1
все надоемоCLOSED09/24/1209/30/12egik19971
freestyle funCLOSED09/26/1212/31/12saggyballs1
40 aa class testCLOSED09/27/1212/01/12rsingiser1
Entamoeba insertion domainCLOSED10/06/1210/12/13lucnoken1
RodrigoCLOSED10/08/1210/16/15Rodrigo9991
Cancer PuzzleCLOSED10/09/1210/11/12beta_helix1
Freestyle design 40CLOSED10/09/1210/09/14meatexplosion1
Freestyle design 20CLOSED10/09/1210/09/14meatexplosion1
Trichoplusia ni. Gloverin ProteinCLOSED10/12/1212/31/13ainstein0011
Penn State Hershey BMS 504CLOSED10/15/1210/28/12iropson1
Frizzled Design Puzzle Contest - October PD CLOSED10/25/1211/01/12katievh1
freestyle testCLOSED10/27/1210/28/12Marek_Berlin1
MetallothioneinCLOSED11/05/1211/30/12Phil.Pa1
Test Scripting - ZKoraCLOSED11/08/1211/30/12ZKora1
AP Bio Puzzle 1CLOSED11/15/1211/18/12APTeach2351
Design 40CLOSED11/17/1212/17/12clptrsn1
hahhaaha cool.CLOSED11/19/1211/23/12joshlitchman1
marolidas sandboxCLOSED11/20/1211/27/12marolidas1
fire and rainCLOSED11/20/1212/22/12mattymoe1
fire and rainCLOSED11/20/1212/22/12mattymoe1
Black Nest of doomCLOSED11/23/1212/31/12mattymoe1
FrizzleCLOSED12/02/1203/02/13marie_s1
Streptococcus pneumoniaeCLOSED12/02/1212/31/12Placebo1
Streptococcus pneumoniae 80CLOSED12/02/1212/31/12Placebo1
>R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN CLOSED12/02/1212/10/12margo3111
Everyone can joinCLOSED12/03/1201/16/13junikl21
HIVCLOSED12/05/1212/29/12Quxwozing1
Test 123CLOSED12/07/1212/14/12RicGray1
Spielwiese Freestyle Design 40CLOSED12/08/1212/31/13Bithalbierer1
bioinformatic task for examCLOSED12/09/1212/20/12margo3111
100 amino acidsCLOSED12/09/1212/20/12margo3111
>R0023 SP18154A, Streptococcus pneumoniae, 100 residuesCLOSED12/09/1212/25/12margo3111
Second partCLOSED12/10/1212/24/12Placebo1
Bio152CLOSED12/13/1201/31/13smfuchs1
Fastest personCLOSED12/13/1212/22/12ponies_rock1
FTN1438CLOSED12/19/1212/31/13nwabu1ao1
11CLOSED12/20/1201/29/13ScottNDean1
Membrane receptorCLOSED12/20/1202/28/13ScottNDean1
Other receptorCLOSED12/20/1212/14/13ScottNDean1
go with the flowCLOSED12/23/1212/30/12Npereira1
Go with the flow 2CLOSED12/23/1212/30/12Npereira1
Stop The HIV ProteaseCLOSED12/28/1212/31/12Evaesion1
Freestyle Design (80 segments)CLOSED01/13/1301/31/14OrigamiMaster1
Testing PuzzleCLOSED01/15/1301/31/13thoyt20121
feqfCLOSED01/21/1301/17/15jinguluninja1
Tau Protein (441 residue htau40)CLOSED01/23/1312/31/16jinguluninja1
testCLOSED01/24/1301/01/14sonneys1
ferer gergeCLOSED01/27/1301/13/16jinguluninja1
THE OCTAGON v2CLOSED02/07/1302/08/13nomatic1
gtpase rasCLOSED02/09/1302/01/15jjwinkle47401
Drosophila Melanogaster nmd protein AAA superfamilyCLOSED02/09/1302/08/14jjwinkle47401
vgsetgethgtr rgwethgCLOSED02/14/1302/14/16oxyi1
scritterTestCLOSED02/15/1302/28/13scritter1
scritterTest2CLOSED02/15/1302/28/13scritter1
biochem assignmentCLOSED02/16/1302/15/14sonneys1
Chicken Noodle SoupCLOSED02/17/1306/22/13mattymoe1
Tbf1CLOSED02/20/1307/17/13Rivsie1
Bioc S13 2nd chanceCLOSED02/26/1302/28/13jcnichols1
thingCLOSED03/03/1303/04/13erek1
Biokemi contestCLOSED03/05/1303/06/13MagnusA1
TestCLOSED03/09/1307/20/13mind_hack1
HBV core proteinCLOSED03/14/1303/23/13Tsogo1
ContestCLOSED03/17/1303/18/13CardsOverCoins1
ISHMIT DAHALCLOSED03/18/1303/19/13USER20131
For testing purposesCLOSED03/19/1303/31/13f00barbob1
a test of rich disordered seqCLOSED03/19/1303/31/13wangxinyu_cn1
FrizzledCLOSED03/21/1303/23/13beta_helix1
3GCLOSED03/25/1304/30/13rvalensia1
Super FreestyleCLOSED03/27/1304/27/13super_Nethergirl1
Super FreestyleCLOSED03/27/1304/27/13super_Nethergirl1
hmmCLOSED04/07/1304/09/13MurloW1
hmCLOSED04/07/1304/09/13MurloW1
Freestyle Design Variable Length. 2 weeksCLOSED04/09/1304/24/13MurloW1
Multi-domain proteinCLOSED04/10/1307/10/13pbartlow1
First moleculeCLOSED04/12/1304/13/13gsandoval1
Freestyle 80 segment de-novoCLOSED04/22/1304/27/13wosser11
Vandeweyer_ProteinCLOSED04/22/1304/30/13gvandeweyer1
5cDraw GutstopenCLOSED04/22/1304/27/13ManVsYard1
P22-NCLOSED04/23/1304/27/13syoifczeri1
P22-N^W[Tb]CLOSED04/23/1304/30/13syoifczeri1
Freestyle Design 80CLOSED05/03/1305/18/13iqbalmahmud1
Small Hepatitis B Surface Antigen (HBsAg)CLOSED05/07/1305/07/14bigben4461
TestCLOSED05/12/1305/17/13MurloW1
testing own scriptCLOSED05/13/1312/31/16Morus1
Family and FriendsCLOSED05/13/1305/07/16LunarEclipse1
ricg contestCLOSED05/17/1305/18/13RicGray1
peptide testCLOSED05/31/1305/17/14syoifczeri1
LOX enzyme from humanCLOSED05/21/1312/24/13magnus groes1
Reinhardt Demo stuffCLOSED06/04/1306/18/13ReinhardtScience1
scienceteach test weeCLOSED06/04/1306/18/13ReinhardtScience1
FOlditExpoCLOSED06/06/1306/11/13ReinhardtScience11
protein desgin CLOSED06/11/1306/14/13ctdevlin1
59 chain proteinCLOSED06/12/1306/30/13ctdevlin1
Start of Sumer HIVCLOSED06/19/1306/26/13nerdysib1
GTPase RasCLOSED06/19/1307/20/13ChinaSESsolve1
PitACLOSED07/16/1308/10/13canthony91
Sorry, This is testCLOSED06/27/1306/28/13myputer1
prueba mioglobinaCLOSED06/30/1306/11/14cmendo1
Just a puzzleCLOSED07/01/1307/31/13wisky1
e235wefCLOSED07/07/1307/23/16phallicies1
YneMCLOSED07/10/1308/17/13canthony91
Acad Alignment PuzleCLOSED07/11/1307/11/14thomasjs2231
Freestyle Design 40CLOSED07/12/1307/12/16Sadler1
Freestyle Design 20CLOSED07/12/1307/12/16Sadler1
UNC SHARP Contest 2CLOSED07/12/1307/31/13jetaiken1
Virus MatrixCLOSED07/15/1308/15/13dbuske1
PfTLPCLOSED07/16/1307/16/14BNGSTE0011
Curing_Mad_Diseases_BroCLOSED07/17/1309/01/13Cyren_Guerrero1
testcol4a3bp2CLOSED07/18/1312/19/13G_H_B1
Adam & TylerCLOSED07/20/1307/23/13Adamdejesus1
Free testCLOSED07/29/1308/23/13eatfears1
how to make unknownyytwCLOSED07/29/1307/31/13chinatsu1
DebuggerCLOSED08/05/1308/11/13Tadasu1
testCLOSED08/19/1308/21/13bkoep1
design testCLOSED08/19/1308/21/13bkoep1
FrizztestCLOSED08/20/1308/31/13spmm1
Small DimerCLOSED08/22/1308/29/13spdenne1
SK SKCLOSED09/01/1312/31/16ScratchKid1
Spider silk designCLOSED09/01/1312/31/16Jirachi1
test dimerCLOSED09/03/1309/06/13jsorr1
Aptamers 1CLOSED09/04/1312/31/13Aiursfallen1
Freestyle Design 80OPEN09/15/1309/15/20Sadler1
NEAR contestCLOSED09/27/1309/29/13nyla121
Small test proteinCLOSED09/17/1312/31/13wudoo1
Small test protein 2CLOSED09/17/1312/31/13wudoo1
silk proteinCLOSED09/22/1309/13/14danielgcc1
HIVCLOSED09/26/1309/24/16ScoobyHusky1
ELAV4_48_118CLOSED09/28/1309/01/14Panoramix1
hiv positiveCLOSED10/03/1310/04/13Mhembrough1
Triple Helix DNACLOSED10/03/1310/31/15Tovi1
SandboxCLOSED10/05/1310/19/13creteen1
Trying to make a Propeller!CLOSED10/08/1310/31/13wisky1
GPCR TestCLOSED10/09/1310/03/14alathb1
easyCLOSED10/09/1312/31/16alex901
Lab SequenceCLOSED10/16/1310/01/14Orangeutan1
Open Design TestCLOSED10/18/1310/19/13picklion1
utacaCLOSED10/25/1311/15/16utaca1
Design testCLOSED11/01/1311/30/13wisky1
Beginner Alignment PuzzleCLOSED11/03/1311/30/13Chris1231
Valentine's dayCLOSED11/06/1302/14/14Compassionate1
Test ContestCLOSED11/06/1301/31/14Roukess1
test2CLOSED11/06/1301/31/14Roukess1
funCLOSED11/21/1312/31/16ninjaeliot1
Yo dawgCLOSED11/25/1311/30/13HelloKittyIslandAdventure1
Obliged to try that!CLOSED12/01/1302/28/14Gabs_the_lil_protein1
IVa2CLOSED11/03/1412/20/14paul.kascak1
IVa2CLOSED11/14/1411/30/14paul.kascak1
IVa2CLOSED11/23/1411/07/15paul.kascak1
sang contesyCLOSED11/30/1312/09/13swl20131
stress responsive protein [Porphyromonas gingivalis SJD2]CLOSED12/06/1312/12/14DashaDv1
Ligand PracticeCLOSED12/07/1312/16/13slofgren1
40 freestyleCLOSED12/09/1312/05/16DashaDv1
dimer testCLOSED12/09/1312/15/16syoifczeri1
Total freedomCLOSED12/09/1312/10/13ahaddad1
Protein LaboratoryCLOSED12/10/1312/25/13slofgren1
trimer testCLOSED12/11/1312/31/15syoifczeri1
mannersCLOSED12/21/1302/28/14Spark51
ABCDEFG HIJKCLOSED12/21/1301/05/14Spark51
Test 611CLOSED12/27/1312/28/13NickyCGS1
Trimer designCLOSED12/28/1312/28/14arivero1
popopopCLOSED12/28/1312/31/13swl20131
Testing ground 3CLOSED12/30/1312/30/14slofgren1
Create-a-Protein ICLOSED01/04/1401/11/14PennyfromHeaven1
SaLLIa666 GameCLOSED01/08/1401/12/14SaLLIa6661
AIDS ATTACKCLOSED01/08/1412/31/17Luciana1
SparkyCLOSED01/09/1403/09/14Spark61
carlosCLOSED01/18/1401/19/14phillida1
UrenaCLOSED01/11/1401/12/14robertito1
MGC 2014CLOSED01/16/1401/22/14Kimbostu1
My 500 TestCLOSED01/17/1402/24/14BCAA1
R3CLOSED01/29/1401/30/14maverickandgoose1
FunnyCLOSED02/01/1404/06/14Spark61
test arlaCLOSED02/07/1402/14/14arlap1
test arla 2CLOSED02/07/1402/14/14arlap1
ligand testCLOSED02/13/1402/12/15syoifczeri1
Test1212CLOSED02/14/1402/15/14NickyCGS1
Test1313CLOSED02/14/1402/15/14NickyCGS1
Test contestCLOSED02/14/1402/15/14NickyCGS1
DCLOSED02/17/1402/24/14MurloW1
Mean, lean, crumple machineCLOSED02/20/1406/22/14mind_hack1
mutate_testCLOSED02/25/1404/25/14robgee1
1CLOSED02/26/1402/27/14egilleh1
TestCLOSED03/03/1403/05/14PeerPride1
TrestCLOSED03/02/1403/13/14PeerPride1
Freestyle Design 100 SandboxCLOSED03/06/1403/31/17viosca1
AntProtFlyCLOSED03/06/1403/05/15Flagg65a1
AntProtFly2CLOSED03/06/1403/05/15Flagg65a1
Raf kinase inhibitorCLOSED03/07/1403/30/14pongoo1
Biol. 312 projectCLOSED03/10/1404/29/14Claire_Rinehart1
Freestyle 40CLOSED03/13/1403/14/14Shpooom1
IQS protein folding contest 2014CLOSED03/17/1403/31/14xevi.biarnes1
Freestyle Design 80CLOSED03/19/1403/20/14thoyt20121
test20CLOSED03/20/1403/20/17Jean-Bob1
De Novo Folding of Auts2CLOSED03/24/1406/24/14ACastanza1
lost points test caseCLOSED03/26/1412/25/14brgreening1
Test32714CLOSED03/27/1403/28/14NickyCGS1
Testmarch2714CLOSED03/27/1403/28/14NickyCGS1
Test 327CLOSED03/27/1403/28/14NickyCGS1
Test Contest 327CLOSED03/27/1403/28/14NickyCGS1
702CLOSED04/01/1406/29/14csqu0011
702CLOSED04/01/1406/01/14csqu0011
80-2CLOSED04/09/1404/16/14test_account11
80-3CLOSED04/09/1404/16/14test_account11
500 for intermediate and beginning playersCLOSED04/15/1404/29/14Andres186000@gmail.com1
Freestyle DCCLOSED04/23/1405/28/14spearandmagichelmet1
vlp de filetteCLOSED04/23/1405/31/14alexram991
ButtCLOSED04/24/1404/25/14dlaplaca1
testCLOSED04/25/1404/26/14kasper421
lost points test twoCLOSED04/25/1404/25/17brgreening1
Test 42514CLOSED04/25/1404/26/14NickyCGS1
design DNA?CLOSED04/29/1404/30/16kibakabul1
test frizzledCLOSED05/16/1405/17/14Seth Cooper1
Frizzled testCLOSED05/16/1405/24/14fankong1
test nanogCLOSED05/16/1405/17/14Seth Cooper1
test abetaCLOSED05/16/1405/17/14Seth Cooper1
test abeta 2CLOSED05/16/1405/17/14Seth Cooper1
indi 500 segment raceCLOSED05/17/1412/31/17jeshprabakaran1
theCLOSED05/19/1405/20/14HAI-YU CHENG1
Test designCLOSED05/29/1405/30/14Valectar1
Testing200CLOSED05/30/1405/31/14NickyCGS1
ConTEST1CLOSED05/30/1405/31/14NickyCGS1
ConTEST2CLOSED05/30/1405/31/14NickyCGS1
ConTEST3CLOSED05/30/1405/31/14NickyCGS1
ConTEST4CLOSED05/30/1405/31/14NickyCGS1
ConTEST5CLOSED05/30/1405/31/14NickyCGS1
ConTEST6CLOSED05/30/1405/31/14NickyCGS1
ConTEST7CLOSED05/30/1405/31/14NickyCGS1
ConTEST8CLOSED05/30/1405/31/14NickyCGS1
ConTEST9CLOSED05/30/1405/31/14NickyCGS1
ConTEST10CLOSED05/30/1405/31/14NickyCGS1
ConTEST11CLOSED05/30/1405/31/14NickyCGS1
ConTEST12CLOSED05/30/1405/31/14NickyCGS1
ConTEST13CLOSED05/30/1405/31/14NickyCGS1
ConTEST14CLOSED05/30/1405/31/14NickyCGS1
ConTEST15CLOSED05/30/1405/31/14NickyCGS1
ConTEST16CLOSED05/30/1405/31/14NickyCGS1
ConTEST17CLOSED05/30/1405/31/14NickyCGS1
ConTEST18CLOSED05/30/1405/31/14NickyCGS1
ConTEST19CLOSED05/30/1405/31/14NickyCGS1
ConTEST20CLOSED05/30/1405/31/14NickyCGS1
ConTEST21CLOSED05/30/1405/31/14NickyCGS1
new testCLOSED06/03/1406/04/14test_account11
Freestyle VarLengthCLOSED06/08/1406/30/14Bithalbierer1
MyoglobinCLOSED06/08/1406/15/14Bithalbierer1
test100CLOSED06/10/1406/11/14Seth Cooper1
test150CLOSED06/10/1406/11/14Seth Cooper1
test200CLOSED06/10/1406/11/14Seth Cooper1
Fight Liver CancerCLOSED06/12/1412/31/14retroneo1
prejudice on HIVCLOSED06/13/1412/16/14manasa1
Test DimerCLOSED06/30/1407/28/14jflat061
Test TrimerCLOSED06/30/1407/28/14jflat061
DrCBDmonCLOSED06/15/1406/30/14angenentmari1
test nanogCLOSED06/17/1406/18/14test_account11
lilovip01CLOSED06/22/1407/22/14lilovip1
Sandboxing, private plsCLOSED07/04/1407/04/15Thardus1
nanogCLOSED07/17/1407/24/14oli-popxD1
:P Fold itCLOSED07/25/1408/09/14I-Love-Computers1
hankg10CLOSED07/28/1407/29/14hankg101
AZV 1CLOSED07/28/1408/09/14azvolpe1
Cux1 p110 Cleavage Domain, 440-753CLOSED08/12/1408/19/14antoine7771
TestCLOSED08/12/1408/13/14antoine7771
figure it outCLOSED08/14/1408/18/14crush21121
HIVCLOSED08/15/1406/30/15Test Lab1
The National Protein TestCLOSED08/22/1408/29/14azak20021
bZIPCLOSED08/28/1409/18/14sven11031
testCLOSED09/27/1406/25/15srettie1
Small PeptidesCLOSED09/27/1411/30/14Batz1
testCLOSED10/01/1410/01/15Orcus1
AMES #1 experementCLOSED10/07/1410/31/14foldase5551
AMES Science fair made me do itCLOSED10/07/1410/31/14foldase5551
foldit proCLOSED10/08/1410/09/14otterballer1
vanabinCLOSED10/10/1410/11/14polli81
Putative Plant ProteinCLOSED10/10/1410/31/14Mecklenburger Friese1
Miso: a critical protein for mosquito reproductionCLOSED10/14/1410/01/16asmidler1
Miso try 2CLOSED10/14/1410/01/17asmidler1
Atg1 ProteinCLOSED10/17/1412/31/14Mecklenburger Friese1
Hypotethical Protein ATU0225CLOSED10/21/1410/09/15gorrila131
A#1284CLOSED10/22/1411/30/14Liam02891
testingCLOSED10/31/1411/01/14ipcfg1
yoCLOSED10/31/1411/01/14otterballer1
Biotek Esp CLOSED11/04/1411/11/14Henriksk1
zincfingersCLOSED11/20/1402/18/15chingsong21
course work testCLOSED11/21/1412/31/14chingsong1
TFPCLOSED11/21/1412/31/14chingsong21
test 80 segment CLOSED11/23/1411/26/15brgreening1
80 Segments EachCLOSED11/24/1412/23/14ElliottB11
SH3PX1CLOSED11/25/1402/28/15Patrick11161
design testCLOSED11/27/1411/30/15ipcfg1
First puzzleCLOSED11/29/1412/03/14r.gore1
dimer a-helix coiled-coil CLOSED11/29/1412/05/14r.gore1
RevDimerCLOSED12/04/1412/05/14Tanamura1
conTestCLOSED12/04/1412/12/14jflat061
conTest2CLOSED12/04/1412/12/14jflat061
Small test 20 segmentCLOSED12/05/1412/01/15aninweton1
small test variable lengthCLOSED12/05/1412/05/15aninweton1
helixCLOSED12/09/1412/31/15ivalnic1
testCLOSED12/11/1412/12/14Bloch_Party1
testCLOSED12/12/1412/13/14bkoep1
my bioinfo assinmentCLOSED01/17/1502/12/15c0d3w4rri0r1
my bio info assinment version 2CLOSED01/17/1502/01/15c0d3w4rri0r1
xCLOSED01/22/1502/18/15jakelmer1
Freestyle Design 40CLOSED01/27/1501/31/18HerobrinesArmy1
Freestyle Design 20CLOSED01/27/1501/31/18HerobrinesArmy1
Freestyle Design 40CLOSED01/30/1512/31/15Hutty1
Freestyle150CLOSED01/30/1501/30/17queentut161
trialCLOSED02/04/1502/08/15jort1
normal contestCLOSED02/04/1502/05/15deephama0011
testmbCLOSED02/10/1502/12/15jakelmer1
Greek Key TestCLOSED02/11/1503/11/15kirkngrant1
mTORCLOSED02/23/1502/23/18kurenan1
freestyle 20CLOSED02/24/1502/24/16manasa1
PorinCLOSED02/27/1503/02/15Jonathan511
Private ContestCLOSED02/27/1502/28/16babacon1
testCLOSED03/03/1503/04/15boltax1
block II testCLOSED03/03/1503/04/15boltax1
protein 3AB [Enterovirus C]CLOSED03/08/1505/08/15orangejayo11
Testing 150CLOSED03/09/1503/27/15HerobrinesArmy1
HBA1 TestCLOSED03/11/1503/13/15minecraft4ever41
HBA1 Test2CLOSED03/11/1503/12/15minecraft4ever41
dyfhyh yghdrhCLOSED03/11/1503/15/15minecraft4ever41
Coiled HelicesCLOSED03/30/1504/04/15Batz1
Freestyle Design 150CLOSED04/02/1504/10/15spacexplorer1
HBMCLOSED04/12/1507/26/15ChrisScientist1
aCLOSED04/06/1504/14/15jinxed1
linkerCLOSED04/11/1504/30/15463418196@qq.com1
Trp-CageCLOSED04/14/1504/14/18ivalnic1
P98CLOSED04/23/1504/30/16hphilipp1
aaaCLOSED04/26/1505/15/15mak3e1
Just For BegginersCLOSED04/29/1504/30/15timothyu1201
cenpHCLOSED05/07/1508/07/15josephab1
Check Cartesian BugCLOSED05/11/1506/30/15brgreening1
helix testCLOSED05/18/1505/27/15dendixon1
HelOPEN05/19/1505/19/19ivalnic1
bioinfCLOSED06/06/1506/10/1523RPE1
bioinf01CLOSED06/06/1506/10/1523RPE1
HIV protease BKCLOSED06/10/1506/11/15bkoep1
Freestyle Design 500CLOSED06/15/1506/22/15pipos11
Test contest for a project at TU ClausthalCLOSED06/20/1506/21/18Shanschke1
Protein Folding with Point mutationsCLOSED07/28/1506/16/18emernic1
Freestyle 500CLOSED06/30/1506/15/18emernic1
Guanlin_HUSTCLOSED07/03/1507/03/16Guanlinli1
Freestyle 40CLOSED07/07/1507/08/15LKluke1
Quinoa TestCLOSED07/09/1507/31/15dinoboy111
Here we goCLOSED07/14/1507/18/15Unwise1
Freestyle Design 40CLOSED07/28/1508/01/15the wheat thin1
A4 testCLOSED07/30/1508/04/15rohtem1
Erv46 KrisCLOSED07/31/1508/07/15kristoferkeiser1
Final ProjectCLOSED08/04/1508/31/15megskene1
lilovip-tests-02OPEN08/05/1508/31/18lilovip1
testCLOSED08/13/1508/14/15sungwon1
TrialCLOSED08/17/1508/20/15OlgaRadchuk1
Duquesne PJAS 2CLOSED09/25/1509/27/15pink_cupcakes1
Duquesne PJAS 3CLOSED09/25/1509/27/15pink_cupcakes1
Duq TestCLOSED09/10/1509/11/15pink_cupcakes1
Oakwood Honors Bio ContestCLOSED09/17/1509/30/15elightrake1
test 1CLOSED09/23/1510/31/15honeypiebeatles1
HappierOPEN09/30/1509/30/18ferricst81
AtuJ1E6-cpGFPOPEN10/01/1510/31/18Lemons1
Test DANIELLECLOSED10/04/1510/17/15petetrig1
USTB workCLOSED10/09/1510/10/15chingsong1
MoeCLOSED10/21/1510/01/16ivalnic1
chaseCLOSED10/28/1510/29/15ChaseLehr12341
EC Fall15CLOSED10/30/1511/15/15jcnichols1
TestCLOSED11/08/1511/30/15Skulduggery1
test 2CLOSED11/09/1512/25/15Skulduggery1
Yay!CLOSED11/10/1511/17/15code cat1
outer envelope protein 80 [Arabidopsis thaliana]CLOSED11/11/1501/06/16swimbug20141
Freestyle 80 TrimerCLOSED11/11/1512/20/16AryehK1
Test contestCLOSED11/23/1511/24/15seantan1
testingCLOSED12/04/1512/08/15vkalas1
invite onlyCLOSED12/04/1512/04/16vkalas1
SymmetryTestCLOSED12/07/1512/08/15Batz1
DIY Protein (A Big One)CLOSED12/11/1512/31/15Atombryan1
HIV solversCLOSED12/31/1504/01/16Sammie1231
Freestyle DesignCLOSED12/16/1512/25/15010100111111
Freestyle Design 20 CLOSED12/16/1512/31/15010100111111
Contest Template Test CLOSED12/21/1512/31/15010100111111
Merry post-christmasCLOSED12/25/1512/28/15-x-1
161CLOSED12/26/1512/31/15shunsuketagami1
di trimmer ligand versionCLOSED12/31/1505/01/16ChrisScientist1
ligamazeCLOSED12/31/1503/31/16ChrisScientist1
Freestyle Design 200 CLOSED01/11/1601/01/17010100111111
Freestyle Design 500 CLOSED01/11/1601/31/16010100111111
Freestyle Symmetric Design: 80 TrimerCLOSED01/15/1601/31/16010100111111
Ice-structuring proteinCLOSED02/01/1602/29/16Tajuton_potilas21
peter and kimCLOSED02/03/1604/02/16petetrig1
peter and kimCLOSED02/03/1606/11/16petetrig1
Freestyle Design 20CLOSED02/08/1602/29/16010100111111
Group V Biophysics BITSGCLOSED02/09/1605/16/16SandyVii1
AMP1CLOSED02/15/1602/17/16grubbybio1
Miami UniversityCLOSED02/18/1602/21/16dirk411
TesteOPEN02/25/1602/12/19NotEvenTryingM81
Pseudomonas aeruginosa PA4063CLOSED02/28/1603/31/16mutinus1
Freestyle Design 40OPEN03/02/1611/23/21khendarg1
Freestyle Design 20OPEN03/02/1601/01/30khendarg1
HIV ProteaseCLOSED03/16/1606/01/16CureForDiabetes1
sgner1CLOSED04/07/1604/08/16sgner1
sgnerTESTCLOSED04/07/1604/08/16sgner1
Fomento CSCLOSED04/19/1604/29/16fomento001
Baltyho prirozeni zda se byt smesne maleCLOSED04/28/1604/29/16MMBP2016-HonJi1
ERN-TransmembranCLOSED04/29/1604/30/16zduzgun1
DENECLOSED04/30/1605/01/16zduzgun1
Viral accessory proteinCLOSED05/03/1605/22/16Zephrin1
Two symmetric chains, 40 segments each; all can be designed.CLOSED05/03/1605/05/16zduzgun1
Contest Template Test CLOSED05/04/1605/06/16zduzgun1
An 500 segment extended chain that can all be designed.CLOSED05/04/1605/06/16zduzgun1
This freestyle puzzle has mutable residues and allows you to add or delete residuesCLOSED05/04/1605/06/16zduzgun1
Freestyle Design 20 CLOSED05/09/1605/29/16010100111111
Lac repressorCLOSED05/17/1605/24/16dunawayjacob1
testCLOSED07/12/1607/13/16guolab1
1CLOSED07/22/1607/23/16liyixiao1
20 segment extended chain that can all be designed.CLOSED07/27/1608/12/16010100111111
BendBobsPlayItYourWayOPEN07/28/1607/28/19bendbob1
1CLOSED08/04/1608/06/16rossco04071
Practice_folding_from_scratchCLOSED08/22/1612/01/16Miguel.alj3901
TIM Barrel DesignCLOSED08/29/1609/02/16Rsteele71
TIM Barrel DesignCLOSED08/29/1609/02/16Rsteele71
TIM BarrelCLOSED09/01/1609/09/16Rsteele71
TIM 200CLOSED09/01/1609/09/16Rsteele71
Help Cure HIVCLOSED09/05/1609/30/16Toyo1
GTPase Ras CLOSED09/16/1612/08/16hgenzman211
Biochem-AD16CLOSED09/23/1610/07/16Yocan1
LOL FU CLOSED09/30/1610/30/16BroC41
test 1CLOSED09/27/1609/29/16ionickiwi1
Variable Length Protein StructureCLOSED09/29/1612/31/16Atombryan1
SandboxCLOSED09/30/1610/02/16CollBio1
my contestCLOSED10/01/1610/30/16Carlos Santamaria1
TestCLOSED10/14/1610/16/16immac6361
raidCLOSED10/19/1610/20/16TheEnderCavalier1
biyokimya_2016_1.haftaCLOSED10/19/1610/23/16biyokimya_2016_ismailhoca1
deneme_1CLOSED10/19/1610/20/16ismailhakkiakgun1
ismailhakkiakgunCLOSED10/19/1610/24/16ismailhakkiakgun1
raid 2CLOSED10/20/1610/21/16TheEnderCavalier1
Breakfast of ChampionsCLOSED11/04/1611/10/16bowman13341
Eric's TestCLOSED11/15/1611/17/16ebrenner141
test-tintin-hivCLOSED11/22/1611/23/16tintin13431
Practice Space--FREESTYLE: VARIABLE LENGTHOPEN11/24/1611/21/18Puttering1
Practice Space--SEAL MYOGLOBINOPEN11/24/1611/21/18Puttering1
TestCLOSED12/03/1612/04/16Justine181
AdventureCLOSED12/03/1612/04/16Justine181
BCH 441 Fold my protein contestCLOSED12/04/1612/05/16ryanolson411
SK SK IIOPEN12/04/1612/31/19ScratchKid1
abeta- binderCLOSED12/06/1612/08/16tintin13431
SK III!OPEN12/07/1612/31/19ScratchKid1
BIOL1300/2300-2016 contestCLOSED12/09/1612/31/16nfawzi1
SK VOPEN12/29/1612/31/19ScratchKid1
SK VIOPEN12/29/1612/31/19ScratchKid1
SK VIICLOSED12/29/1612/31/92ScratchKid1
1v Foldit 1CLOSED01/02/1701/18/17kipasceu1
TrollFace gamesCLOSED01/12/1701/14/17TrollFace20021
Biochem 463 lab 1CLOSED01/24/1701/25/17BWeber1
iCLOSED01/27/1701/30/17zduzgun1
SK VIIOPEN02/02/1712/31/20ScratchKid1
test contestCLOSED02/07/1702/28/17brbfold1
TwelverOPEN02/12/1712/31/20ScratchKid1
erjOPEN02/12/1712/31/20ScratchKid1
iRFPOPEN02/13/1702/13/20amao11
iRFP 2OPEN02/13/1702/13/20amao11
Test Contest for LornaCLOSED02/17/1702/19/17dsilva.l1
axin solveCLOSED02/14/1702/16/17NiPatFeb20171
#awesomeCLOSED03/02/1703/03/17roachfamilymaine1
Test 3V1ACLOSED03/02/1705/02/17Scopper1
Freestyle Design 40 Contest #1CLOSED03/06/1703/13/17FutureScientist12121
Freestyle Design 80 Contest #2CLOSED03/13/1703/20/17FutureScientist12121
testCLOSED03/07/1703/08/17lhatsk1
TestCLOSED03/12/1703/14/1728SciOne1
Test2CLOSED03/12/1703/19/1728SciOne1
SEAL MYOGLOBINCLOSED03/13/1705/11/17srinaldi16561
Super EasyCLOSED04/01/1705/03/17AndriiMiller1
Chem 365? CLOSED04/02/1704/30/17koehlr60chem3651
ForfCLOSED04/10/1704/11/17Leser1
200-residue design puzzle testCLOSED04/12/1704/18/17LociOiling1
CheckCLOSED05/12/1705/14/17ProfCollins1
freestyle synthetic protein designsCLOSED06/12/1707/12/17jigs1
QQCLOSED06/21/1707/20/17416074311
freestyle 20CLOSED07/25/1708/22/17PatricioBato1
Freestyle 40CLOSED07/25/1708/24/17PatricioBato1
Chains!CLOSED08/03/1709/02/17Mao Mao1
Custom 500CLOSED08/07/1709/06/17khendarg1
Cell BioCLOSED08/22/1708/24/17Dr.Chi1
testA1CLOSED08/24/1708/25/17ksz1
FreedomCLOSED09/13/1709/14/17LilinC331
HIV TroubleCLOSED09/18/1709/30/17LOGOLOZ1
Ronny-testCLOSED09/22/1709/30/17ronnygeo1
Frestyle contestCLOSED10/04/1710/08/17maximiliancarey1
Test Custom Contest - dev03CLOSED10/09/1710/12/17ronnygeo1
Extracellular peptideCLOSED10/18/1710/25/17danielofs1
DONG1 proteinCLOSED10/20/1711/11/17cxlpku1
test 1CLOSED10/20/1710/31/17cxlpku1
me and freindsCLOSED11/05/1711/07/17Nusayr1
test123CLOSED11/07/1711/08/17horowsah1
WTF! BOOMCLOSED12/01/1712/03/17DomasterPM1
CoolCLOSED12/02/1701/01/18BaiYang1
A Test Custom Contest - fold.itCLOSED12/29/1712/31/17Seth Cooper1
test9CLOSED12/29/1712/30/17horowsah1
name nameCLOSED01/01/1801/05/18010100111111
name 2CLOSED01/01/1801/20/18010100111111
name 500CLOSED01/01/1801/20/18010100111111
name 150CLOSED01/02/1801/19/18010100111111
Noc Biologów testCLOSED01/09/1801/12/18decu1
test17CLOSED01/09/1801/10/18horowsah1
test18CLOSED01/09/1801/10/18horowsah1
test19CLOSED01/09/1801/10/18horowsah1
test20CLOSED01/09/1801/10/18horowsah1
test21CLOSED01/09/1801/10/18horowsah1
test22CLOSED01/09/1801/10/18horowsah1
test23CLOSED01/09/1801/10/18horowsah1
DUSP6CLOSED01/13/1802/11/18Bruno Kestemont1
DUSP6CLOSED01/13/1802/11/18Bruno Kestemont1
testCLOSED01/12/1801/24/18Uttkarsh1
test contest 04CLOSED01/13/1801/31/18josh041
test for josh03CLOSED01/15/1801/22/18josh031
testbibsCLOSED01/16/1801/17/18Addreoran1
Human NeuritinCLOSED01/25/1802/24/18Topo241
test contestCLOSED02/05/1802/08/18samicheen1
Test custom contestCLOSED02/06/1802/11/18samicheen1
For FunCLOSED02/12/1803/12/18srinaldi16561
ackaCLOSED02/15/1803/17/18rolfpf1
HIVCLOSED03/01/1803/29/18horowsah1
groelCLOSED03/01/1803/29/18horowsah1
enzymeCLOSED03/01/1803/29/18horowsah1
ADAMCLOSED02/28/1803/27/18psloliveira1
citodomainCLOSED02/28/1803/27/18psloliveira1
2002949_0000_from_scooperCLOSED03/26/1803/31/18bkoep1
2003169_S953CLOSED03/25/1803/31/18bkoep1
test17CLOSED04/05/1804/06/18horowsah1
test18CLOSED04/05/1804/06/18horowsah1
test19CLOSED04/05/1804/06/18horowsah1
cavs 49-30CLOSED04/06/1804/13/1820133451
CCBs-Next-TopModelCLOSED04/09/1804/30/18AnnaSophalK1
Turma 302 COLTECCLOSED04/09/1804/20/18camiladlopes1
Desafio proteínas do HIVCLOSED04/09/1804/20/18camiladlopes1
biotekCLOSED04/10/1804/13/18Aminstrater1
4bws testCLOSED04/11/1804/13/18bkoep1
test30CLOSED04/16/1804/17/18horowsah1
test32CLOSED04/23/1804/24/18horowsah1
test32CLOSED04/26/1804/27/18horowsah1
test33CLOSED05/01/1805/02/18horowsah1
Challanger40sCLOSED05/02/1805/27/18MatheRaph1
customposter contestCLOSED05/03/1805/31/18customposter1
test34CLOSED05/03/1805/05/18horowsah1
2003333_0006 zipCLOSED05/03/1805/17/18bkoep1
2003333_0006 zip2CLOSED05/06/1805/27/18bkoep1
test_edit2CLOSED05/06/1805/13/18bkoep1
test35CLOSED05/06/1805/07/18horowsah1
test36444CLOSED05/06/1805/07/18horowsah1
Freestyle Design: Variable LengthCLOSED05/10/1805/11/18ac2812011
500 proteine CLOSED05/14/1805/18/18010100111111
Heather and Nate CLOSED05/16/1805/17/18heatherlapier1
testCLOSED05/16/1805/17/18customposter1
test1CLOSED05/16/1805/17/18customposter1
test2CLOSED05/16/1805/17/18customposter1
Test FDVLCLOSED05/21/1806/20/18Madde1
Loci's test contest testCLOSED05/21/1805/22/18LociOiling1
test2CLOSED05/22/1805/31/18customposter1
test3CLOSED05/22/1805/31/18customposter1
test pdbCLOSED05/24/1805/25/18samicheen1
2003333_0006_testCLOSED05/24/1805/31/18bkoep1
test puzzleCLOSED05/24/1805/25/18samicheen1
test puzzle newCLOSED05/24/1805/25/18samicheen1
test pdbCLOSED05/30/1805/31/18samicheen1
testtCLOSED06/06/1806/07/18horowsah1
5GOZ test contest 6.3CLOSED06/06/1807/04/18Matthew Hantsbarger1
5GOZ test contest 6.8OPEN06/19/1807/17/18Matthew Hantsbarger1
Abeta Binder Test2CLOSED06/25/1807/02/18Matthew Hantsbarger1
What can you do???CLOSED06/25/1806/26/18Carrie_W1
The coolest in 5212CLOSED06/29/1807/09/18CarlQAQ1
testOPEN07/07/1807/31/18tyler09111
nanobodyOPEN07/09/1808/07/18Bogdan Barnych1
GeneDesign2ndOPEN07/12/1807/29/18chingsong1
testCLOSED07/13/1807/14/18qk90311
Another ContestCLOSED04/17/1004/22/10TheGUmmer2
Recipe testerCLOSED05/31/1007/01/10Datstandin2
Simpler recipe testerCLOSED05/31/1006/30/10Datstandin2
find the various aminosCLOSED07/06/1012/31/10smith92clone2
the grand finalCLOSED08/17/1012/31/13cyclic32
ygkasCLOSED08/13/1308/17/14sotk2
Dubons Class ContestCLOSED09/08/1009/10/10dubon12
bjarke join migCLOSED10/04/1010/05/10aske20102
Open University ChallengeCLOSED11/20/1012/18/10ilya.makedon2
BioContestCLOSED01/27/1101/28/11cbehling2
the only tournament here! (for now)CLOSED05/10/1106/10/11shrock2
TESTCLOSED06/14/1106/18/11csac19592
contestCLOSED06/26/1107/13/11madpenguin2
GTPase RasCLOSED09/23/1110/07/11Miah2
Michael and MarcoCLOSED10/05/1110/06/11bigbanggd4102
TR624CLOSED10/25/1111/06/11beta_helix2
A Computer TesterCLOSED12/09/1112/08/12mat7472
BLARGCLOSED12/20/1112/21/11Chappers2
HIV proteaseCLOSED01/16/1201/20/12recondite72
Some Test ContestCLOSED01/26/1202/05/12Biology-EtcManager2
love vs. loveCLOSED02/22/1202/24/12k.love2
vroom2CLOSED02/24/1203/24/12kasmol2
TFS dwewfCLOSED04/03/1204/04/12jperoff2
Freestyle Design 500CLOSED04/16/1204/29/12drumpeter18yrs9yrs2
contestCLOSED04/22/1204/24/12yesir2
contest de folditCLOSED05/15/1205/18/12Alakazam Einstein2
33mer From Shan et. al.CLOSED05/23/1206/30/12scooper142
testerCLOSED06/01/1206/02/12CharlieFortsConscience2
CASP9 Target 611 residue proteinCLOSED06/18/1206/18/13meatexplosion2
YesCLOSED07/24/1207/25/12JBrown23222
AlbertCLOSED11/13/1211/14/12Albert_tanjaya2
Black Nest of DoomCLOSED11/23/1212/31/12mattymoe2
fold it contestCLOSED11/29/1211/30/12ylecroy2
cancer helpCLOSED12/06/1212/31/13jordansapp12
ww domainCLOSED01/08/1301/31/13deans2
fahdkabaniCLOSED02/20/1302/21/13fahdkabani2
pechi demoCLOSED03/03/1306/07/13anthunk2
Elijahs contestCLOSED03/08/1303/31/13ilikediamonds2
Moar Freestyle Design. 80 seg, 1 weekCLOSED03/26/1304/02/13MurloW2
Biotech WFB 1CLOSED03/28/1304/09/13KBrown2
Wisks ContestCLOSED04/06/1304/30/13WiskIRC2
Adam & TylerCLOSED07/20/1307/23/13Adamdejesus2
Science aidsCLOSED08/09/1308/12/13sience geek2
Solve for TreatmentCLOSED08/30/1309/10/13PirateX122
SK SKCLOSED09/01/1312/31/16ScratchKid2
1 week Freestyle 80seg Trimer DesignCLOSED08/30/1309/06/13MurloW2
BIIN351_1CLOSED09/04/1309/18/13ash2
Contest CLOSED10/25/1310/27/13DDarling2
what is this???CLOSED12/02/1312/05/13Niiikola2
PoliteCLOSED12/21/1304/25/14Spark52
testing Foldit minimize split intein 3NZMCLOSED01/02/1401/02/16sagearbor2
carlosCLOSED01/10/1401/11/14bharani942
testCLOSED02/12/1402/13/14l_like2
jhdfksaufsahkmdCLOSED02/28/1403/02/14spider8762
test 80 trimer 327CLOSED03/27/1403/28/14NickyCGS2
40-2CLOSED04/09/1404/16/14test_account12
40-3CLOSED04/09/1404/16/14test_account12
Test, festyn bibsCLOSED05/15/1405/19/14Behoston2
Dino contestCLOSED05/14/1405/15/14isabelfer2
Abeta Binder Piecewise DesignCLOSED05/30/1406/21/14fankong2
FirstTryCLOSED10/15/1410/17/14Waverka.102
TFP200CLOSED11/25/1412/31/14chingsong22
Design_testCLOSED12/03/1412/04/14bkoep2
MichaelCLOSED04/26/1504/28/16jinxed2
Contest #1CLOSED05/30/1505/30/16pizpot2
Chem2208CLOSED10/02/1510/03/15u55863002
yoyoyoCLOSED10/24/1512/03/15Aria Deng2
easronCLOSED11/16/1511/17/15EastonSickels12342
Leishmania donovani Ornithine decarboxylaseCLOSED11/20/1511/25/15mikroplasma2
3. y biometrixCLOSED11/30/1511/30/16blomsterman2
JJT twincomboCLOSED11/30/1501/31/16Canadian KId2
Easy DIY Protein (For more precision then the other one)CLOSED12/11/1512/31/15Atombryan2
WSU Bioc Fall 16CLOSED10/20/1611/03/16jcnichols2
MC&SDRocksCLOSED02/27/1702/24/18SunSalutation2
Team 11 TestCLOSED03/18/1703/19/1750SciOne2
testCommCLOSED07/22/1708/20/17dsilva.l2
GlobalCLOSED12/16/1712/17/17ckluo2
phosphateCLOSED03/01/1803/29/18horowsah2
2003333_0006CLOSED05/06/1805/27/18bkoep2
Custom ContestCLOSED05/08/1805/10/18customposter2
Heather and Nate Round 2 CLOSED05/16/1805/17/18heatherlapier2
Heather and Nate Round 3 LOL CLOSED05/16/1805/17/18heatherlapier2
trialCLOSED05/22/1805/31/18customposter2
Lindert OSC DayCLOSED06/20/1806/22/18bowman13342
40 Seg Design ContestCLOSED04/15/1004/20/10TheGUmmer3
testing the contestCLOSED04/15/1005/15/10mat7473
Crashguard303 Script testCLOSED06/07/1006/14/10Crashguard3033
Freestyle for allCLOSED11/01/1012/05/10thosi3
SBGCLOSED02/18/1102/19/11crma3
Ligand PracticeCLOSED05/24/1109/11/11tyler09113
UCSF DNA Challenge CLOSED10/25/1111/06/11beta_helix3
MontcrestCLOSED12/20/1101/31/12Chappers3
ligan practice -open to allCLOSED03/21/1203/31/12Mike Tate3
(Closed) PEP Private Contest III CLOSED05/22/1205/31/12prolylendopeptidase3
Dana_NicoloCLOSED04/17/1204/18/12dananumber133
Common Immunogenic Substrate (Fragment)CLOSED05/23/1206/30/12scooper143
500 residue freestyle!CLOSED08/16/1208/20/14meatexplosion3
Malaria PuzzleCLOSED10/09/1210/11/12beta_helix3
Flu PuzzleCLOSED10/09/1210/11/12beta_helix3
BCHS3201CLOSED02/20/1302/25/13fahdkabani3
Bioc 2nd chance (S13)CLOSED02/28/1303/02/13jcnichols3
UCDS Test ContestCLOSED03/25/1304/30/13UCDS_Test3
40 segment Freestyle Design. 2 weeks. CLOSED03/22/1304/06/13MurloW3
SMIM1 CLOSED03/24/1303/31/13gestur3
Beginner Alignment Puzzle Sup'BiotechCLOSED07/12/1307/13/13Darksliver3
UNC SHARP Contest 1CLOSED07/12/1307/31/13jetaiken3
Investigate Inspect TestCLOSED08/20/1308/21/13NickyCGS3
Abeta contest CampBIOmedCLOSED07/09/1407/11/14kaurg3
Nanog Transcription factor contestCLOSED07/29/1407/31/14kaurg3
Flute lets go sonCLOSED09/30/1410/01/14FluteJasonKarakaedos3
MedChem14CLOSED10/16/1410/27/14pedrofong3
Lets have funCLOSED01/11/1501/13/15imenm3
the ice dragons playhouseCLOSED02/06/1502/28/15the ice dragon3
testCLOSED02/10/1502/10/16silverberg3
Greek Key V2.0CLOSED03/30/1504/15/15jakelmer3
PRACTICE TEST 1CLOSED12/08/1512/09/15seantan3
PRACTICE TEST 2CLOSED12/08/1512/09/15seantan3
ContestCLOSED04/14/1604/15/16mxwly3
Test Contest - MLCLOSED05/01/1608/31/16MrMark20143
My ContestCLOSED11/04/1611/05/16Benbennett20003
contestCLOSED08/01/1708/31/17folditguy1230983
Lol tuturialCLOSED02/20/1802/21/18danielvan19943
2002949_0000CLOSED03/25/1804/22/18bkoep3
TEST UofGuelph iGEM 2018 oxITCLOSED05/21/1806/20/18RestrictionEndoNykolease3
Loci's variable length design contestOPEN07/03/1807/31/18LociOiling3
CASP9 611 residueCLOSED05/29/1006/15/10Mark-4
New small testCLOSED06/17/1007/30/10Crashguard3034
Script test ligandCLOSED10/20/1001/31/11Crashguard3034
Alignment battleCLOSED12/12/1012/31/10Nikaeo4
Histone H1CLOSED01/03/1101/31/11Dj-P4
2011-11 small FreestyleCLOSED02/22/1112/31/11Crashguard3034
Freestyle Design 500 CLOSED04/28/1105/31/11Acida-24
Freestyle Design - 80 (Anthropic Dreams team members)CLOSED06/17/1106/22/11Seagat20114
LETSGOCLOSED08/26/1108/27/11wudoo4
the contestCLOSED10/21/1110/28/11Mozzi4
Polish ContestCLOSED11/20/1112/20/11Mojzesz4
Spielwiese - Freestyle Design (Variable Length)CLOSED12/25/1103/31/12Bithalbierer4
Moloney Murine Leukaemia Virus Matrix Protein CLOSED02/01/1202/03/12beta_helix4
H3 Hemagglutinin Flu Design PuzzleCLOSED02/01/1202/03/12beta_helix4
(Closed) PEP Private Contest IICLOSED04/12/1204/18/12prolylendopeptidase4
Wolfer's ClassCLOSED05/31/1206/06/12NTWII4
A london Olympic contest!CLOSED08/05/1208/12/12junh8214
2 weeks, 80 segment design.CLOSED04/27/1305/11/13MurloW4
testCLOSED07/04/1307/05/13Raphsup4
Sup'BioFoldCLOSED07/04/1307/05/13Darksliver4
ABETA PROTEIN COMPETITIONCLOSED07/29/1408/01/14kaurg4
HivCLOSED12/07/1412/01/15dbuske4
Real Oakwood Honors Bio ContestCLOSED09/17/1509/30/15elightrake4
SHSCLOSED11/20/1511/21/15fanerdbcshs4
Miniprotein1L2YCLOSED04/23/1705/23/17Bruno Kestemont4
Science One Team 10 ProjectCLOSED03/20/1704/01/1706SciOne4
5GOZ Test ContestCLOSED05/24/1806/21/18Matthew Hantsbarger4
Twisting of the protein (v.2)CLOSED01/01/1101/31/11Dj-P5
CompbioCLOSED08/22/1108/23/11hahnbeom5
Compbio2CLOSED08/22/1108/23/11hahnbeom5
Compbio3CLOSED08/22/1108/23/11hahnbeom5
Compbio4CLOSED08/22/1108/23/11hahnbeom5
Join if u DareCLOSED04/26/1304/20/14srgp20125
Camp BIOmed 2015 Week1CLOSED07/06/1507/10/15apklock5
Camp BIOmed 2015 Week2CLOSED07/13/1507/17/15apklock5
Team 5 ProjectCLOSED03/12/1703/31/1728SciOne5
team 6!!CLOSED03/21/1703/25/1720SciOne5
Mr Faure 1v1 me lmao 100XDDDDDDDDDDDCLOSED11/14/1711/15/17B0B05
PM_2CLOSED01/18/1801/27/18PM_KSienkiewicz5
5GOZ test contest 6CLOSED05/29/1806/26/18Matthew Hantsbarger5
Script test IIICLOSED08/12/1010/12/10Crashguard3036
AP BIO Extra CreditCLOSED09/24/1009/25/10jesalomone116
Knotfind onCLOSED12/10/1112/31/11beta_helix6
Adelphi FHB DesignCLOSED05/02/1305/12/13ligandfinder6
Long linksCLOSED04/21/1204/30/12AsDawnBreaks6
DSSP algorithm vs NR data baseCLOSED05/29/1206/29/12BitSpawn6
Testing puzzleCLOSED06/03/1210/03/12Ch Garnier6
Toxic Gluten MoleculeCLOSED07/11/1207/29/12scooper146
Toxic Gluten PeptideCLOSED07/11/1207/29/12scooper146
Sugar Binding PuzzleCLOSED07/24/1207/30/12beta_helix6
HIV protease - BIOL225CLOSED01/16/1401/22/14Kimbostu6
Red Block 2 | The Foldit GamesCLOSED01/30/1402/07/14xXF4T3D_P4R4D0Xx6
Camp BIOmed NANOG contestCLOSED08/11/1408/13/14kaurg246
Amyloid Beta contest - CampBIOmedCLOSED08/12/1408/14/14kaurg246
Camp BIOmed week 4CLOSED07/27/1507/31/15apklock6
Week 5 Camp BIOmedCLOSED08/03/1508/07/15apklock6
King of the ClassCLOSED12/10/1512/11/15crostomily6
DuquesnePJAS1CLOSED09/23/1609/25/16EmilyB6
DuquesnePJAS2CLOSED09/23/1609/25/16EmilyB6
DuquesnePJAS3CLOSED09/23/1609/25/16EmilyB6
HIV Protease FoldingCLOSED05/10/1705/13/17Komsomolez6
Chem 2225 Spring 2011 ContestCLOSED03/09/1103/31/11brian.parker7
Alignment tool (join link in desc)CLOSED10/26/1112/31/11riking7
HIVCLOSED12/20/1101/31/12Chappers7
Spielwiese - HIV ProteaseCLOSED12/25/1103/31/12Bithalbierer7
Homology Modeling Course: HIV ProteaseCLOSED06/12/1206/15/12obiwan7
DR.B JWU BIOCHEM Contest-HIV proteaseCLOSED01/08/1302/17/13drmbudziszek7
Biostructure ContestCLOSED05/07/1405/08/14Komsomolez7
Abeta protein CampBIOmedCLOSED07/15/1407/20/14kaurg7
C4lab-Friendly ContestCLOSED11/04/1411/23/14yi-an Tung7
killenCLOSED04/23/1504/24/15woops7
BF Mol DynamicsCLOSED05/22/1505/25/15Ivelina Zaharieva7
Camp BIOmed 2015 Week 7CLOSED08/17/1508/21/15apklock7
BC 124CLOSED11/30/1612/06/16roandavila7
MGC - 2017CLOSED01/18/1701/24/17Kimbostu7
F20 for testingCLOSED12/24/1002/28/11Rav3n_pl8
FreestyleCLOSED10/08/1210/07/13asdf98
Freestyle Variable Length. 1 month. CLOSED02/26/1303/25/13MurloW8
The Final ModelCLOSED05/15/1305/16/13WheeDhee8
Best holiday designCLOSED12/21/1412/31/14Skippysk8s8
Practice ContestCLOSED12/10/1512/11/15crostomily8
DU Phosphorous 2018CLOSED01/11/1801/26/18horowsah8
Homology_Praktikum_IBK_SS11CLOSED06/16/1106/20/11csac19599
more thunk testingCLOSED03/29/1206/30/12anthunk9
nmd AAA ATPaseCLOSED02/09/1302/08/14jjwinkle47409
free style 101CLOSED12/02/1312/25/13Jaceno9
BIOL225 2014CLOSED01/16/1401/22/14Kimbostu9
We are bored - Design Trimer ContestCLOSED08/02/1508/16/15jamiexq9
Duquesne PJAS 1CLOSED09/25/1509/27/15pink_cupcakes9
University of Edinburgh Biophysical chemistry workshop 2017CLOSED03/21/1707/01/17jmichel809
3V1ACLOSED04/23/1705/23/17Bruno Kestemont9
Structural-BioinformaticsCLOSED04/24/1705/08/17AnnaSophalK9
Bio-Tech 2k17CLOSED10/20/1710/21/17JosephNi9
Why not, really?CLOSED12/22/1001/22/11anthunk10
80 segment freestyle design. 1 month. CLOSED01/29/1302/28/13MurloW10
Supbiotech ACLOSED04/24/1404/25/14ChloeAudrey10
Nanog Transcription Factor Contest - CampBIOmedCLOSED07/15/1407/16/14kaurg10
DU TAR 2018CLOSED01/11/1802/02/18horowsah10
DU Chaperone 2018CLOSED01/11/1802/09/18horowsah10
DU Enzyme 2018CLOSED01/17/1802/16/18horowsah10
CH 410 ECCLOSED02/09/1803/09/18ProfCollins10
DU AB 2018CLOSED02/12/1803/12/18horowsah10
Twisting of the protein (v1.0)CLOSED12/28/1004/15/11Dj-P11
Script testingCLOSED11/23/1212/31/15Jean-Bob11
Clayton Biochemistry Spring 2014CLOSED02/24/1405/01/14rsingiser11
HIV proteaseCLOSED03/27/1404/04/14Professor West11
HIV Protease - BIOL225CLOSED01/22/1501/29/15Siderhurst11
HIV protease - BIOL225CLOSED01/28/1602/04/16Siderhurst11
Collins CH 410CLOSED02/01/1705/10/17ProfCollins11
WerncsCLOSED12/07/1712/08/17caitlin@newcitycharterschool.org11
PM_PEGAZCLOSED03/20/1803/31/18PM_KSienkiewicz11
Time to Cure Cancer- Once and For All!CLOSED03/01/1106/01/11tyler091112
biol200-3-23-11CLOSED04/04/1104/09/11gabhsa12
Server models for T0743 ContestCLOSED10/13/1205/13/13Ch Garnier12
Wulff's Fantastic Core ChallengeCLOSED01/27/1402/28/14-Jacoby-12
Sup'bio02CLOSED04/24/1404/27/14isaa5412
Greek Key ChallengeCLOSED01/25/1502/10/15jakelmer12
Biophysical chemistry workshop - University of EdinburghCLOSED02/08/1604/25/16jmichel8012
Chem 1307 Spring 2011 ContestCLOSED03/09/1103/31/11brian.parker13
Noc Biologow 2018 WB UWCLOSED01/12/1801/13/18decu13
WSC Bioc1 S18 ECCLOSED04/02/1804/22/18jcnichols13
CASP 9: Nycticorax nycticorax's mystery.CLOSED01/01/1101/15/11Dj-P14
SEAL MYOGLOBINCLOSED11/23/1101/31/12Ch Garnier14
Two Day Beat Back the Boredom PuzzleCLOSED01/24/1301/26/13auntdeen14
New_contestCLOSED11/07/1412/09/14pedrofong14
Frizzled Design ContestCLOSED11/30/1412/06/14ingoneato14
Exam 2 EC Spring 2015CLOSED03/27/1504/05/15jcnichols14
EC Fall15CLOSED10/29/1511/15/15jcnichols14
Biochem 1 Extra CreditCLOSED11/17/1712/15/17ProfCollins14
Biophysical chemistry workshop University of EdinburghCLOSED01/12/1802/11/18jmichel8014
Acida's testCLOSED09/22/1009/30/10Acida-215
3 day speed foldingCLOSED01/24/1301/27/13jamiexq15
Clayton Biochemistry Summer 13CLOSED07/03/1307/24/13rsingiser15
CH 410 Puzzle 1CLOSED11/30/1612/13/16ProfCollins15
CHE 8592 Greek Key ChallengeCLOSED02/09/1702/16/17jakelmer15
WSC Bioc 1 F17 ECCLOSED11/03/1711/18/17jcnichols15
Biophysical chemistry workshop University of Edinburgh TestCLOSED12/19/1412/03/15jmichel8016
WSU Bioc 1 S18CLOSED04/05/1704/23/17jcnichols16
Bioinfor KasetCLOSED09/19/1009/27/10kiattawee17
Clayton Biochemistry Fall 12CLOSED09/30/1212/01/12rsingiser17
Multi-Start Bacteroides Vulgatus Contest CLOSED10/13/1204/13/13Ch Garnier17
Frizzled Design because we are boredCLOSED01/24/1301/27/13jamiexq17
Foldit tura pierwszaCLOSED05/23/1405/25/14Behoston17
WSU Fall 16 BiochemistryCLOSED11/02/1611/20/16jcnichols17
bioc_3CLOSED01/26/1202/14/12bkuhlman18
Bioc EC #2CLOSED10/16/1210/17/12jcnichols18
WSC Bioc Spring 2016CLOSED03/25/1604/10/16jcnichols18
bioc_670_designCLOSED02/01/1202/15/12bkuhlman19
SEAL MYOGLOBINCLOSED05/25/1211/25/12Ch Garnier19
Another Beat Back the Boredom Old StyleCLOSED01/24/1301/26/13auntdeen19
MPICLOSED10/31/1311/30/13Mengzzz19
Align-itCLOSED08/14/1008/21/10Arbot36020
HIV proteaseCLOSED09/17/1009/18/10skoddet120
You choose the number of residuesCLOSED02/11/1502/28/18michaeled31420
BIOL1300/2300 Abeta binderCLOSED12/12/1612/31/16biol1300_nick20
UCSF Intro PuzzleCLOSED10/21/1110/25/11beta_helix21
BIOL1300/2300 FrizzledCLOSED12/12/1612/31/16biol1300_nick21
Sandbox puzzle for CASP9CLOSED05/02/1005/19/10beta_helix22
The Marathon of Foldit: 611 residues big puzzle chalengeCLOSED12/03/1312/02/16Bruno Kestemont22
Ligand Folding Practice- Open to allCLOSED05/01/1109/01/11tyler091123
Test Puzzle to Fix ClientCLOSED02/08/1202/29/12beta_helix23
Bioc670_1CLOSED01/22/1102/10/11bkuhlman24
SAC Summer 2012 OChem ChallengeCLOSED06/04/1206/10/12brian.parker24
UCDS April ContestCLOSED04/01/1304/30/13UCDS_A024
'Brave New World' Class PuzzleCLOSED04/22/1005/02/10beta_helix25
Clayton Biochemistry Spring 13CLOSED02/25/1305/05/13rsingiser25
Bioc WSCCLOSED03/06/1203/08/12jcnichols27
Bioc WSC ECCLOSED03/25/1203/31/12jcnichols27
Penn State Hershey BMS 504 Contest 2CLOSED10/15/1210/28/12iropson27
courseworkCLOSED11/20/1412/31/14chingsong27
Chem 431 contestCLOSED08/24/1109/19/11laurabee28
Flu Puzzle CompetitionCLOSED10/09/1210/11/12beta_helix28
Client TestsCLOSED12/04/1312/31/16Matthew Krueger28
HIV fight!CLOSED08/22/1008/31/10Rav3n_pl29
Moloney Murine Leukaemia Virus Matrix Protein CLOSED02/14/1205/15/12Ch Garnier29
USTB2017CLOSED11/29/1712/29/17chingsong29
Bioc F12 EC#1CLOSED10/11/1210/15/12jcnichols30
Bioc EC Fall 2014CLOSED10/28/1411/15/14jcnichols32
Nanog Homeobox Protein (NANOG)CLOSED03/07/1203/07/13Ch Garnier34
Anyone can join, HIV Protease, OPEN TO ALLCLOSED01/06/1302/10/13Phillipthegreat34
Frizzled Design Puzzle ContestOPEN02/11/1512/31/18michaeled31435
WSU Bioc (S13)CLOSED02/18/1302/20/13jcnichols37
Pace Academy 2014 HIV proteaseCLOSED08/21/1312/21/13thattori37
Extra credit for examCLOSED10/23/1310/31/13jcnichols37
testCLOSED04/16/1204/22/12test_account141
Freestyle Design a 500 length Protein!CLOSED12/09/1312/31/16Matthew Krueger43
Back to the FutureCLOSED04/18/1705/16/17chingsong43
New City Charter School CLOSED12/09/1712/10/17caitlin@newcitycharterschool.org43
200 Residue Freestyle!CLOSED08/21/1308/21/14meatexplosion44
No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein. CLOSED06/01/1206/30/12phi1646
BIOC530CLOSED12/04/1412/12/14bkoep46
Foldit University ChallengeCLOSED11/05/1011/19/10ilya.makedon47
HIV protease sandboxCLOSED05/04/1105/01/14tyler091149
Open 500 Segment design puzzle CLOSED09/09/1212/31/15Ryanfav49
Freestyle Design this 500 residue protein - Seagat2011CLOSED12/17/1001/14/12Seagat201150
Educurious Frizzled Design Puzzle Contest! CLOSED02/10/1303/31/13katievh51
GeneDesignCLOSED03/08/1804/07/18chingsong55
Test your PC powerCLOSED12/03/1309/30/16Bruno Kestemont59
Rv0657c - small protein from Mycobacterium tuberculosis H37RvCLOSED08/23/1108/31/14rws61
Nanog Transcription FactorOPEN02/11/1512/31/18michaeled31466
'for everyoneCLOSED12/04/1001/09/11anthunk67
A Freestyle Design 40 Open to allCLOSED08/14/1108/31/12itskimo68
BIG CASP9 contestCLOSED08/23/1102/01/12wudoo68
GeneEngineeringCLOSED05/16/1706/15/17chingsong68
A Freestyle Design 80 Open to allCLOSED08/14/1109/30/12itskimo69
testOPEN05/24/1112/31/19gurch70
80 and everyoneCLOSED05/15/1212/31/12Alakazam Einstein73
One last CASP9 Target!CLOSED08/25/1009/28/10beta_helix74
Design SpaceCLOSED06/15/1206/21/14drummerdude20480
Rv0500B - small protein from Mycobacterium tuberculosis H37RvCLOSED08/24/1108/10/14rws92
Biology-NanogContestCLOSED02/03/1202/29/12Seth Cooper99
Lastest contest against the cancerCLOSED03/30/1212/31/15Dj-P105
BHS - Nanog Contest CLOSED04/24/1205/12/12katievh125
The Marathon of Foldit - New ChapterCLOSED02/01/1402/28/17Bruno Kestemont126
[DEPRECATED] GTPase Ras long run *Anyone can join!*CLOSED01/28/1412/31/15AsDawnBreaks128
Everyone Join!CLOSED06/28/1212/24/13lakeyja900130
A GTPase Ras Open To AllCLOSED08/27/1109/30/12itskimo131
HIV ProteaseCLOSED01/21/1203/03/12recondite7159
GTPase Ras Long b [Open to all] [Open discussion]CLOSED01/28/1412/31/17AsDawnBreaks169
Anyone Can Join (freestyle design 80)CLOSED07/19/1007/18/11spy club202
Abeta BinderOPEN02/11/1512/31/18michaeled314260
A Freestyle Design 20 Open to allCLOSED08/14/1108/31/12itskimo288
Fight AIDSCLOSED12/09/1312/31/16Matthew Krueger290
HIV's end CLOSED02/13/1112/31/14Dj-P305
A HIV Protease open to all CLOSED08/27/1109/30/12itskimo496
Let's Cure Cancer FinallyCLOSED08/18/1012/31/13mikedressner691
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons