Log in to Create Template Contest

All Contests (Only Show Open Contests)

Namesort iconStatusStart DateEnd DateOwnerPlayers
An 500 segment extended chain that can all be designed.CLOSED05/04/1605/06/16zduzgun1
how to make unknownyytwCLOSED07/29/1307/31/13chinatsu1
theCLOSED05/19/1405/20/14HAI-YU CHENG1
vghubzysd rxCLOSED07/31/1112/31/13oxyi1
#awesomeCLOSED03/02/1703/03/17roachfamilymaine1
'Brave New World' Class PuzzleCLOSED04/22/1005/02/10beta_helix25
'for everyoneCLOSED12/04/1001/09/11anthunk67
(Closed) PEP Private Contest IICLOSED04/12/1204/18/12prolylendopeptidase4
(Closed) PEP Private Contest III CLOSED05/22/1205/31/12prolylendopeptidase3
1CLOSED02/26/1402/27/14egilleh1
1CLOSED08/19/1008/31/10lipasesucks1
1CLOSED07/22/1607/23/16liyixiao1
1CLOSED08/04/1608/06/16rossco04071
1 week Freestyle 80seg Trimer DesignCLOSED08/30/1309/06/13MurloW2
100 amino acidsCLOSED12/09/1212/20/12margo3110
100 amino acidsCLOSED12/09/1212/20/12margo3111
11CLOSED12/20/1201/29/13ScottNDean1
12CLOSED08/19/1008/31/10lipasesucks1
13-mer toxic peptidesCLOSED05/23/1205/31/12hanhnguyen141
161CLOSED12/26/1512/31/15shunsuketagami1
1v Foldit 1CLOSED01/02/1701/18/17kipasceu1
1v Foldit-1 F2017CLOSED01/05/1701/18/17kipasceu0
1V1 ME UNLESS UR SCAREDCLOSED10/19/1710/21/17I dom1nate0
2 weeks, 80 segment design.CLOSED04/27/1305/11/13MurloW4
20 amino acid-- proteinCLOSED08/06/1408/24/14Barbaramoshi0
20 seg script testCLOSED06/05/1012/31/10srssmith921
20 segment extended chain that can all be designed.CLOSED07/27/1608/12/16010100111111
200 Residue Freestyle!CLOSED08/21/1308/21/14meatexplosion44
200-residue design puzzle testCLOSED04/12/1704/18/17LociOiling1
2002290_S122CLOSED01/09/1901/16/19bkoep2
2002949_0000CLOSED03/25/1804/22/18bkoep3
2002949_0000 testCLOSED03/22/1803/31/18Seth Cooper0
2002949_0000_from_scooperCLOSED03/26/1803/31/18bkoep1
2003169_S953CLOSED03/25/1803/31/18bkoep1
2003333_0006CLOSED05/06/1805/27/18bkoep2
2003333_0006 zipCLOSED05/03/1805/17/18bkoep1
2003333_0006 zip2CLOSED05/06/1805/27/18bkoep1
2003333_0006_testCLOSED05/24/1805/31/18bkoep1
2011-11 small FreestyleCLOSED02/22/1112/31/11Crashguard3034
20aaCLOSED06/27/1906/30/19usagi5251
233233233CLOSED06/09/1906/11/19ABF0
23333333abcde qqeeeeeeeq eeqCLOSED06/09/1906/11/19njfuzjs1
3 day speed foldingCLOSED01/24/1301/27/13jamiexq15
3. y biometrixCLOSED11/30/1511/30/16blomsterman2
33mer From Shan et. al.CLOSED05/23/1206/30/12scooper142
3GCLOSED03/25/1304/30/13rvalensia1
3V1ACLOSED04/23/1705/23/17Bruno Kestemont9
40 aa class testCLOSED09/27/1212/01/12rsingiser1
40 freestyleCLOSED12/09/1312/05/16DashaDv1
40 Seg Design ContestCLOSED04/15/1004/20/10TheGUmmer3
40 segmentCLOSED07/16/1007/18/10icreatemac0
40 Segment ChainCLOSED04/22/1204/30/14michaeled3141
40 segment Freestyle Design. 2 weeks. CLOSED03/22/1304/06/13MurloW3
40-2CLOSED04/09/1404/16/14test_account12
40-3CLOSED04/09/1404/16/14test_account12
430CLOSED08/03/1108/04/11laurabee1
46 KrisCLOSED07/31/1508/07/15kristoferkeiser0
4bws testCLOSED04/11/1804/13/18bkoep1
500 for intermediate and beginning playersCLOSED04/15/1404/29/14Andres186000@gmail.com1
500 proteine CLOSED05/14/1805/18/18010100111111
500 residue freestyle!CLOSED08/16/1208/20/14meatexplosion3
565645646CLOSED06/11/1006/12/10yjh0
576iCLOSED05/21/1112/31/14oxyi1
59 chain proteinCLOSED06/12/1306/30/13ctdevlin1
5cDraw GutstopenCLOSED04/22/1304/27/13ManVsYard1
5GOZ 9.0 testCLOSED07/19/1807/26/18Matthew Hantsbarger2
5GOZ Test ContestCLOSED05/24/1806/21/18Matthew Hantsbarger4
5GOZ test contest 6CLOSED05/29/1806/26/18Matthew Hantsbarger5
5GOZ test contest 6.3CLOSED06/06/1807/04/18Matthew Hantsbarger1
5GOZ test contest 6.8CLOSED06/19/1807/17/18Matthew Hantsbarger1
702CLOSED04/01/1406/29/14csqu0011
702CLOSED04/01/1406/01/14csqu0011
80 and everyoneCLOSED05/15/1212/31/12Alakazam Einstein73
80 segment freestyle design. 1 month. CLOSED01/29/1302/28/13MurloW10
80 Segments EachCLOSED11/24/1412/23/14ElliottB11
80-2CLOSED04/09/1404/16/14test_account11
80-3CLOSED04/09/1404/16/14test_account11
80segmentCLOSED07/12/1007/31/10asianboy261
:P Fold itCLOSED07/25/1408/09/14I-Love-Computers1
>R0023 SP18154A, Streptococcus pneumoniae, 100 residuesCLOSED12/09/1212/25/12margo3111
>R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN CLOSED12/02/1212/10/12margo3111
??CLOSED12/20/1001/01/11reedbc1
aCLOSED07/11/1007/25/10asianboy261
aCLOSED11/27/1112/19/11JimmyFraktal1
aCLOSED04/06/1504/14/15jinxed1
A Battle in DesignCLOSED03/14/1303/14/14TheEnderCavalier0
A Computer TesterCLOSED12/09/1112/08/12mat7472
A Freestyle Design 20 Open to allCLOSED08/14/1108/31/12itskimo288
A Freestyle Design 40 Open to allCLOSED08/14/1108/31/12itskimo68
A Freestyle Design 80 Open to allCLOSED08/14/1109/30/12itskimo69
A GTPase Ras Open To AllCLOSED08/27/1109/30/12itskimo131
A HIV Protease open to all CLOSED08/27/1109/30/12itskimo496
A london Olympic contest!CLOSED08/05/1208/12/12junh8214
A Test Custom ContestCLOSED12/29/1712/31/17Seth Cooper0
A Test Custom Contest - fold.itCLOSED12/29/1712/31/17Seth Cooper1
A Test Custom Contest 2 - fold.itCLOSED12/29/1712/31/17Seth Cooper0
a test of rich disordered seqCLOSED03/19/1303/31/13wangxinyu_cn1
A#1284CLOSED10/22/1411/30/14Liam02891
a-Synuclein Inhibitor TestCLOSED10/03/1810/31/18SleepyPanda1231
a.lCLOSED07/13/1007/15/10asianboy261
A4 testCLOSED07/30/1508/04/15rohtem1
aaaCLOSED04/26/1505/15/15mak3e1
AATG TK BioteknologiCLOSED10/04/1010/08/10thomas.holm@gmail.com1
abcCLOSED04/14/1804/15/18samicheen0
ABCDEFG HIJKCLOSED12/21/1301/05/14Spark51
Abeta BinderCLOSED02/11/1512/31/18michaeled314296
Abeta Binder Piecewise CLOSED06/28/1907/27/19helen882
Abeta Binder Piecewise DesignCLOSED08/16/1808/31/18Uttkarsh1
Abeta Binder Piecewise DesignCLOSED05/30/1406/21/14fankong2
Abeta Binder Test2CLOSED06/25/1807/02/18Matthew Hantsbarger1
Abeta contest CampBIOmedCLOSED07/09/1407/11/14kaurg3
Abeta protein CampBIOmedCLOSED07/15/1407/20/14kaurg7
ABETA PROTEIN COMPETITIONCLOSED07/29/1408/01/14kaurg4
abeta- binderCLOSED12/06/1612/08/16tintin13431
Acad Alignment PuzleCLOSED07/11/1307/11/14thomasjs2231
Acida's testCLOSED09/22/1009/30/10Acida-215
ackaCLOSED02/15/1803/17/18rolfpf1
ACPCLOSED10/27/1110/12/12mike r0
ACPCLOSED10/27/1110/12/12mike r1
Acyl HydrolaseCLOSED04/03/1204/04/12MichaelGasse1
ADAMCLOSED02/28/1803/27/18psloliveira1
Adam & TylerCLOSED07/20/1307/23/13Adamdejesus2
Adam & TylerCLOSED07/20/1307/23/13Adamdejesus1
Adelphi FHB DesignCLOSED05/02/1305/12/13ligandfinder6
Adisdzik dzikCLOSED05/14/1905/24/19stanio1
AdventureCLOSED12/03/1612/04/16Justine181
AelCLOSED05/20/1206/03/12Aralys1
AELCLOSED02/14/1702/15/17JaeYeong0
aendgraend tested contestsCLOSED06/09/1006/13/10aendgraend1
AIDSCLOSED12/08/1012/31/11colonelpaco1
AIDS ATTACKCLOSED01/08/1412/31/17Luciana1
Aids SecurityCLOSED09/02/1001/22/11Gaara1
ajCLOSED09/23/1109/24/11ilikeike1
AlabudzkiCLOSED11/06/1012/31/10alabudzki1
AlbA,CLOSED12/03/1801/02/19icaru-51
AlbertCLOSED11/13/1211/14/12Albert_tanjaya2
Ali GCLOSED01/22/1801/29/18JonnyT0
Align-itCLOSED08/14/1008/21/10Arbot36020
AlignmentCLOSED10/02/1012/31/10sielenk1
AlignmentCLOSED10/02/1012/31/10sielenk0
Alignment battleCLOSED12/12/1012/31/10Nikaeo4
Alignment testCLOSED07/23/1107/24/11harvardman0
Alignment tool (join link in desc)CLOSED10/26/1112/31/11riking7
AmazingCLOSED05/13/1405/18/14Botanix0
AMES #1 experementCLOSED10/07/1410/31/14foldase5551
AMES Science fair made me do itCLOSED10/07/1410/31/14foldase5551
AMP1CLOSED02/15/1602/17/16grubbybio1
Amyloid Beta contest - CampBIOmedCLOSED08/12/1408/14/14kaurg246
An ExperimentCLOSED05/15/1905/20/19Phil81
Another Beat Back the Boredom Old StyleCLOSED01/24/1301/26/13auntdeen19
Another ContestCLOSED04/17/1004/22/10TheGUmmer2
another testCLOSED05/17/1805/19/18josh030
AntProtFlyCLOSED03/06/1403/05/15Flagg65a1
AntProtFly2CLOSED03/06/1403/05/15Flagg65a1
any one can join tooCLOSED06/26/1109/01/11plh1
anyone can join (actually)CLOSED07/05/1112/16/11madpenguin0
Anyone Can Join (freestyle design 80)CLOSED07/19/1007/18/11spy club202
Anyone can join, HIV Protease, OPEN TO ALLCLOSED01/06/1302/10/13Phillipthegreat34
AP BIO Extra CreditCLOSED09/24/1009/25/10jesalomone116
AP BIO Pd. 3CLOSED10/28/1511/03/15smuheisen10
AP Bio Puzzle 1CLOSED11/15/1211/18/12APTeach2351
Aptamers 1CLOSED09/04/1312/31/13Aiursfallen1
arabic groupCLOSED09/22/1109/22/14ahmed magdy1
Are you kidding me?CLOSED11/13/1811/14/18jcnichols1
ARSBCLOSED06/10/1607/29/16szeitler180
artificial muscleCLOSED03/25/1203/31/12AkimotoYuki0
asdfCLOSED01/09/1801/31/18Seth Cooper0
asdfadfCLOSED07/05/1007/29/10RoboMonkey1
asfCLOSED11/27/1111/30/11JimmyFraktal0
assasaCLOSED06/10/1006/11/10yjh1
AT TestingCLOSED12/22/1012/26/10anthunk1
AT Testing TooCLOSED12/22/1012/26/10anthunk1
Atg1 ProteinCLOSED10/17/1412/31/14Mecklenburger Friese1
Atoh1 Atonal homolog 1CLOSED07/11/1108/01/11RANimick0
AtuJ1E6-cpGFPCLOSED10/01/1510/31/18Lemons1
axin solveCLOSED02/14/1702/16/17NiPatFeb20171
AZV 1CLOSED07/28/1408/09/14azvolpe1
Back to the FutureCLOSED04/18/1705/16/17chingsong43
Backbone DesignCLOSED07/02/1907/09/19bkoep2
Baltyho prirozeni zda se byt smesne maleCLOSED04/28/1604/29/16MMBP2016-HonJi1
battle royalCLOSED09/17/1309/19/13delay0
BattleGrounds....v.5655.88CLOSED08/31/1008/24/13InsaneGamer14571
BC 124CLOSED11/30/1612/06/16roandavila7
BC 124 - UPM - FoldIt ChallengeCLOSED09/24/1810/08/18Quantumerical16
BCH 441 Fold my protein contestCLOSED12/04/1612/05/16ryanolson411
BCHS 3201CLOSED09/26/1111/30/11Fotis NKS0
BCHS 3201CLOSED09/26/1111/30/11Fotis NKS0
BCHS3201CLOSED02/20/1302/25/13fahdkabani3
Beat it! CLOSED08/17/1208/18/12Quinton8300
begginerCLOSED01/10/1201/19/12bobbyjoejr0
Beginner Alignment PuzzleCLOSED12/06/1112/31/11kitek314_pl1
Beginner Alignment puzzleCLOSED11/04/1011/11/10science.nerd0
Beginner Alignment PuzzleCLOSED11/03/1311/30/13Chris1231
Beginner Alignment PuzzleCLOSED01/02/1101/01/12maksimlekler1
Beginner Alignment Puzzle Sup'BiotechCLOSED07/12/1307/13/13Darksliver3
Beginner HIV proteaseCLOSED08/07/1208/10/12rarkenin1
Beginner PuzzleCLOSED10/05/1810/07/18yayiding1
Beginner puzzle copyCLOSED05/31/1005/18/12Krog1
Beginner Puzzle ProCLOSED10/05/1810/20/18yayiding1
Beginners gameCLOSED04/11/1104/17/11Zsolesz840
Beginning Alignment PuzzleCLOSED02/04/1102/12/11ltchong0
bend itCLOSED10/25/1711/05/17Marlfox30
BendBobsPlayItYourWayCLOSED07/28/1607/28/19bendbob1
Best DesignCLOSED11/09/1411/30/14David_M12310
Best holiday designCLOSED12/21/1412/31/14Skippysk8s8
best scoreCLOSED09/17/1009/21/10Willbee1
Beta-carotene dioxygenaseCLOSED10/13/1011/05/10mbarnkob0
BF Mol DynamicsCLOSED05/22/1505/25/15Ivelina Zaharieva7
BHS - Nanog Contest CLOSED04/24/1205/12/12katievh125
BiChE Easy puzzleCLOSED12/08/1012/10/10ejf3c1
BIG CASP9 contestCLOSED08/23/1102/01/12wudoo68
Big WinCLOSED08/14/1212/31/15alexlan0
BIIN351_1CLOSED09/04/1309/18/13ash2
binding motif testCLOSED02/16/1102/03/12ceventer1
Bio 152ECCLOSED02/06/1202/16/12smfuchs1
Bio chem assignmentCLOSED02/16/1302/15/14sonneys0
Bio-Tech 2k17CLOSED10/20/1710/21/17JosephNi9
Bio152CLOSED12/13/1201/31/13smfuchs1
BIo152 ECCLOSED02/07/1202/16/12smfuchs1
Bioc 2nd chance (S13)CLOSED02/28/1303/02/13jcnichols3
Bioc EC #2CLOSED10/16/1210/17/12jcnichols18
Bioc EC Fall 2014CLOSED10/28/1411/15/14jcnichols32
Bioc F12 EC#1CLOSED10/11/1210/15/12jcnichols30
Bioc S13 2nd chanceCLOSED02/26/1302/28/13jcnichols1
Bioc WSCCLOSED03/06/1203/08/12jcnichols27
Bioc WSC ECCLOSED03/06/1203/07/12jcnichols1
Bioc WSC ECCLOSED03/25/1203/31/12jcnichols27
BIOC530CLOSED12/04/1412/12/14bkoep46
Bioc670_1CLOSED01/22/1102/10/11bkuhlman24
Biochem 1 Extra CreditCLOSED11/17/1712/15/17ProfCollins14
Biochem 124CLOSED11/12/1611/13/16John Carlo dela Cruz0
Biochem 463 lab 1CLOSED01/24/1701/25/17BWeber1
biochem assignmentCLOSED02/16/1302/15/14sonneys1
Biochem-AD16CLOSED09/23/1610/07/16Yocan1
BioClassCLOSED04/11/1204/15/12sarahod231
bioconCLOSED07/26/1207/27/12aurabum1
BioContestCLOSED01/27/1101/28/11cbehling2
bioc_3CLOSED01/26/1202/14/12bkuhlman18
Bioc_670_2CLOSED01/26/1202/10/12bkuhlman1
bioc_670_designCLOSED02/01/1202/15/12bkuhlman19
Bioc_670_ProteaseCLOSED01/26/1202/10/12bkuhlman1
bioinfCLOSED06/06/1506/10/1523RPE1
bioinf01CLOSED06/06/1506/10/1523RPE1
bioinf02CLOSED06/06/1506/10/1523RPE0
Bioinfor KasetCLOSED09/19/1009/27/10kiattawee17
bioinformatic task for examCLOSED12/09/1212/20/12margo3110
bioinformatic task for examCLOSED12/09/1212/20/12margo3110
bioinformatic task for examCLOSED12/09/1212/20/12margo3111
Biokemi contestCLOSED03/05/1303/06/13MagnusA1
Biol. 312 projectCLOSED03/10/1404/29/14Claire_Rinehart1
BIOL1300/2300 Abeta binderCLOSED12/12/1612/31/16biol1300_nick20
BIOL1300/2300 FrizzledCLOSED12/12/1612/31/16biol1300_nick21
BIOL1300/2300-2016 contestCLOSED12/09/1612/31/16nfawzi1
biol1300_2018CLOSED01/01/3012/31/18biol1300_nick19
biol1300_2018_2CLOSED12/06/1812/31/18biol1300_nick19
biol1300_2018_3CLOSED12/06/1812/31/18biol1300_nick16
biol200-3-23-11CLOSED04/04/1104/09/11gabhsa12
BIOL225 2014CLOSED01/16/1401/22/14Kimbostu9
Biology-NanogContestCLOSED02/03/1202/29/12Seth Cooper99
Biophysical chemistry workshop - University of EdinburghCLOSED02/08/1604/25/16jmichel8012
Biophysical chemistry workshop University of EdinburghCLOSED01/12/1802/11/18jmichel8014
Biophysical chemistry workshop University of Edinburgh TestCLOSED12/19/1412/03/15jmichel8016
Biostructure ContestCLOSED05/07/1405/08/14Komsomolez7
Biotech WFB 1CLOSED03/28/1304/09/13KBrown2
Biotech WFB HIVCLOSED03/28/1304/09/13KBrown0
biotekCLOSED04/10/1804/13/18Aminstrater1
Biotek Esp CLOSED11/04/1411/11/14Henriksk1
biyokimya_2016_1CLOSED10/19/1610/23/16biyokimya_2016_ismailhoca0
biyokimya_2016_1.haftaCLOSED10/19/1610/23/16biyokimya_2016_ismailhoca1
bjarke join migCLOSED10/04/1010/05/10aske20102
blablaCLOSED03/17/1203/24/12ccilia1
Black box42CLOSED02/09/1102/11/11DaVinci211
Black Nest of doomCLOSED11/23/1212/31/12mattymoe0
Black Nest of doomCLOSED11/23/1212/31/12mattymoe1
Black Nest of DoomCLOSED11/23/1212/31/12mattymoe2
BlankCLOSED01/04/1112/31/11kevinjh1
BLARGCLOSED12/20/1112/21/11Chappers0
BLARGCLOSED12/20/1112/21/11Chappers2
Blarghs contestCLOSED04/30/1212/31/12blargh1231
Block 11CLOSED11/16/1711/26/17drigginar0
block II testCLOSED03/03/1503/04/15boltax1
BMI 206 test contest - proteaseCLOSED10/12/1110/13/11amelie.stein1
BMI 206 test contest - RasCLOSED10/12/1110/14/11amelie.stein1
bonebreakeCLOSED09/09/1009/17/10baeda1
BP's 611CLOSED09/10/1009/11/10Bletchley Park1
BrainUnwind-ContestDCLOSED07/23/1907/29/19PhilippeMarguet1
Breakfast of ChampionsCLOSED11/04/1611/10/16bowman13341
bugsterCLOSED03/05/1104/30/11alex20111
ButtCLOSED04/24/1404/25/14dlaplaca1
bZIPCLOSED08/28/1409/18/14sven11031
C21ECLCLOSED02/21/1202/25/12lijiahua19841
C21ECL-1CLOSED02/21/1202/24/12lijiahua19841
C4lab-Friendly ContestCLOSED11/04/1411/23/14yi-an Tung7
CalzolaiCLOSED09/01/1011/08/10iRob0
CameronCLOSED04/03/1204/04/12Cameron Baxendale0
CameronCLOSED04/03/1204/04/12Cameron Baxendale1
Camp BIOmed 2015 Week 7CLOSED08/17/1508/21/15apklock7
Camp BIOmed 2015 Week1CLOSED07/06/1507/10/15apklock5
Camp BIOmed 2015 Week2CLOSED07/13/1507/17/15apklock5
Camp BIOmed NANOG contestCLOSED08/11/1408/13/14kaurg246
Camp BIOmed week 4CLOSED07/27/1507/31/15apklock6
Can you foldit?CLOSED01/03/1204/20/12S-Man0
Can you win?CLOSED01/06/1201/07/12thekidsglenn71
cancer helpCLOSED12/06/1212/31/13jordansapp12
Cancer PuzzleCLOSED12/11/1112/25/11EzraThexton1
Cancer PuzzleCLOSED10/09/1210/11/12beta_helix1
Cancer Treatment ContestCLOSED03/24/1204/24/12DaVinci211
carlosCLOSED01/18/1401/19/14phillida1
carlosCLOSED01/10/1401/11/14bharani942
CASP 9: Nycticorax nycticorax's mystery.CLOSED01/01/1101/15/11Dj-P14
CASP TrainingCLOSED02/18/1204/30/12nealk1
casp trainingCLOSED10/20/1110/31/11vk19821
CASP training puzzleCLOSED01/02/1101/01/12maksimlekler1
CASP13CLOSED12/05/1812/31/18callmekoo1
CASP9 611 residueCLOSED05/29/1006/15/10Mark-4
CASP9 targed Design test, all welcomeCLOSED03/01/1107/01/11tyler09111
CASP9 Target 611CLOSED10/24/1011/30/10cd111
CASP9 Target 611 residue proteinCLOSED01/02/1101/01/12maksimlekler1
CASP9 Target 611 residue proteinCLOSED06/18/1206/18/13meatexplosion2
CASP9 target Design? CLOSED01/02/1101/01/12maksimlekler1
CASPtrainingCLOSED06/10/1306/30/13Linux_Penguin0
cavs 49-30CLOSED04/06/1804/13/1820133451
CCCLOSED01/05/1201/07/12obson0
CCBs-Next-TopModelCLOSED04/09/1804/30/18AnnaSophalK1
CD44 proteinCLOSED08/14/1008/24/10mikedressner1
Cell BioCLOSED08/22/1708/24/17Dr.Chi1
cenpHCLOSED05/07/1508/07/15josephab1
CH 410 ECCLOSED02/09/1803/09/18ProfCollins10
CH 410 Puzzle 1CLOSED11/30/1612/13/16ProfCollins15
Chains!CLOSED08/03/1709/02/17Mao Mao1
Challanger40sCLOSED05/02/1805/27/18MatheRaph1
chaseCLOSED10/28/1510/29/15ChaseLehr12341
CHE 8592 Greek Key ChallengeCLOSED02/09/1702/16/17jakelmer15
CHE 8592 Greek Key Challenge 2019CLOSED01/28/1902/12/19jakelmer9
CHE 8592 Greek Key Challenge 2019 v2.0CLOSED02/11/1902/26/19jakelmer17
CHE 8592 Greek Key Challenge 2019 v3.0CLOSED02/27/1903/12/19jakelmer1
CheckCLOSED05/12/1705/14/17ProfCollins1
Check Cartesian BugCLOSED05/11/1506/30/15brgreening1
Chem 1307 Spring 2011 ContestCLOSED03/09/1103/31/11brian.parker13
CHEM 1460 PuzzleCLOSED02/04/1102/12/11ltchong1
CHEM 1460 Puzzle 2CLOSED02/04/1102/11/11ltchong1
Chem 2225 Spring 2011 ContestCLOSED03/09/1103/31/11brian.parker7
Chem 365? CLOSED04/02/1704/30/17koehlr60chem3651
Chem 431 contestCLOSED08/24/1109/19/11laurabee28
Chem2208CLOSED10/02/1510/03/15u55863002
chemchem111CLOSED02/01/1202/02/12nlite5101
Chicken Noodle SoupCLOSED02/17/1306/22/13mattymoe1
CH_410_ECCLOSED01/01/3004/04/19ProfCollins12
citodomainCLOSED02/28/1803/27/18psloliveira1
clamp testCLOSED03/30/1203/31/12hilaryar1
CLASS CONTESTCLOSED02/29/1603/31/16Herojohn170
Clayton Biochemistry Fall 12CLOSED09/30/1212/01/12rsingiser17
Clayton Biochemistry Spring 13CLOSED02/25/1305/05/13rsingiser25
Clayton Biochemistry Spring 2014CLOSED02/24/1405/01/14rsingiser11
Clayton Biochemistry Summer 13CLOSED07/03/1307/24/13rsingiser15
CLEAN ME!!!!!!!!!!!!!!!!!CLOSED02/17/1202/18/12Bjamin1
Client TestsCLOSED12/04/1312/31/16Matthew Krueger28
ClpBCLOSED10/09/1110/28/12kevinjh1
Coiled HelicesCLOSED03/30/1504/04/15Batz1
Collins CH 410CLOSED02/01/1705/10/17ProfCollins11
Come and PlayCLOSED10/31/1310/22/16roxyroxy0
Come at me BroCLOSED01/08/1501/12/15GentlestElm290
COME JOINCLOSED07/13/1907/31/19Cloudy1011
Come join my constest -Cloudy101 CLOSED06/15/1906/29/19Cloudy1011
Common Immunogenic Substrate (Fragment)CLOSED05/23/1206/30/12scooper143
CompbioCLOSED08/22/1108/23/11hahnbeom5
Compbio2CLOSED08/22/1108/23/11hahnbeom5
Compbio3CLOSED08/22/1108/23/11hahnbeom5
Compbio4CLOSED08/22/1108/23/11hahnbeom5
contestCLOSED08/01/1708/31/17folditguy1230983
Contest CLOSED10/25/1310/27/13DDarling2
contestCLOSED09/27/1112/25/11meganium2140
contestCLOSED09/27/1112/25/11meganium2140
ContestCLOSED04/14/1604/15/16mxwly3
ContestCLOSED03/16/1303/31/13dallinac0
ContestCLOSED03/17/1303/18/13CardsOverCoins1
contestCLOSED04/22/1204/24/12yesir2
contestCLOSED06/26/1107/13/11madpenguin2
contestCLOSED03/19/1105/22/11protein1231
ContestCLOSED07/30/1207/31/12Nicbudd770
conTestCLOSED12/04/1412/12/14jflat061
Contest #1CLOSED05/30/1505/30/16pizpot2
Contest :)CLOSED07/02/1907/03/19helen881
contest de folditCLOSED05/15/1205/18/12Alakazam Einstein2
Contest nameCLOSED03/03/1603/04/16Kristian Rodman0
Contest name goes here?CLOSED08/02/1008/05/10oakwhiz1
Contest Template Test CLOSED12/21/1512/31/15010100111111
Contest Template Test CLOSED01/02/1101/01/12maksimlekler1
Contest Template Test CLOSED05/04/1605/06/16zduzgun1
Contest Template Test and testingOPEN01/01/3009/17/19lansefeixue1
ConTEST1CLOSED05/30/1405/31/14NickyCGS1
ConTEST10CLOSED05/30/1405/31/14NickyCGS1
Contest10000G1CLOSED09/14/1010/01/10crispy fry1
ConTEST11CLOSED05/30/1405/31/14NickyCGS1
ConTEST12CLOSED05/30/1405/31/14NickyCGS1
ConTEST13CLOSED05/30/1405/31/14NickyCGS1
ConTEST14CLOSED05/30/1405/31/14NickyCGS1
ConTEST15CLOSED05/30/1405/31/14NickyCGS1
ConTEST16CLOSED05/30/1405/31/14NickyCGS1
ConTEST17CLOSED05/30/1405/31/14NickyCGS1
ConTEST18CLOSED05/30/1405/31/14NickyCGS1
ConTEST19CLOSED05/30/1405/31/14NickyCGS1
ConTEST2CLOSED05/30/1405/31/14NickyCGS1
conTest2CLOSED12/04/1412/12/14jflat061
ConTEST20CLOSED05/30/1405/31/14NickyCGS1
ConTEST21CLOSED05/30/1405/31/14NickyCGS1
ConTEST3CLOSED05/30/1405/31/14NickyCGS1
ConTEST4CLOSED05/30/1405/31/14NickyCGS1
ConTEST5CLOSED05/30/1405/31/14NickyCGS1
ConTEST6CLOSED05/30/1405/31/14NickyCGS1
ConTEST7CLOSED05/30/1405/31/14NickyCGS1
ConTEST8CLOSED05/30/1405/31/14NickyCGS1
ConTEST9CLOSED05/30/1405/31/14NickyCGS1
contest_node_form contest_node_formCLOSED05/10/1805/13/18customposter0
CoolCLOSED12/02/1701/01/18BaiYang0
CoolCLOSED12/02/1701/01/18BaiYang1
coolkids2 contestCLOSED07/06/1207/07/12meelock1
coolkids2 contestCLOSED07/06/1207/07/12meelock0
course work testCLOSED11/21/1412/31/14chingsong1
courseworkCLOSED11/20/1412/31/14chingsong27
CRACCLOSED01/31/1202/23/12testdudetest1
Crashguard303 Script testCLOSED06/07/1006/14/10Crashguard3033
CRAZYCLOSED03/12/1103/17/11alex20111
Create-a-Protein ICLOSED01/04/1401/11/14PennyfromHeaven1
CURE CANCER win CLOSED09/24/1109/25/12Ross31
Curing_Mad_Diseases_BroCLOSED07/17/1309/01/13Cyren_Guerrero1
Custom 500CLOSED08/07/1709/06/17khendarg1
Custom ContestCLOSED05/08/1805/10/18customposter2
Custom Contest 1CLOSED05/08/1805/10/18customposter0
custom contest test 2CLOSED05/07/1805/14/18Seth Cooper0
custom contest test 3CLOSED05/07/1805/14/18Seth Cooper0
customposter contestCLOSED05/03/1805/31/18customposter1
Cux1 p110 Cleavage Domain, 440-753CLOSED08/12/1408/19/14antoine7771
cyrusi's challangeCLOSED02/17/1201/01/15cyrusi0
DCLOSED02/17/1402/24/14MurloW1
d oCLOSED08/23/1208/23/15Joanna Staite0
D&A MessCLOSED04/28/1507/12/15ChrisScientist0
Daddy'sCLOSED11/30/1012/25/10TheDaddyTired0
dan shit CLOSED10/05/1310/06/13nosleevesforlife0
Dana_NicoloCLOSED04/17/1204/18/12dananumber133
Dave's challenge of despairCLOSED02/23/1702/24/17bsdn0
DAYDER VIRTUALIZATIONCLOSED10/30/1310/20/14Roman Rozin0
DcmBCLOSED04/18/1207/13/12shadowwalk0
De Novo Folding of Auts2CLOSED03/24/1406/24/14ACastanza1
De-Extinction!CLOSED07/10/1307/31/13gordon_wade0
DebuggerCLOSED08/05/1308/11/13Tadasu1
Degradation of Wood! Lets understand methane and CO2 production!CLOSED01/21/1209/30/12losWEEDos1
DENECLOSED04/30/1605/01/16zduzgun1
deneme_1CLOSED10/19/1610/20/16ismailhakkiakgun1
Dengue Virus NS3 protease domainCLOSED09/26/1110/31/11Neffets1
Denovo design 1CLOSED09/18/1810/01/18zhart1
Desafio proteínas do HIVCLOSED04/09/1804/20/18camiladlopes1
designCLOSED11/22/1212/31/13smart guy0
Design 200CLOSED09/13/1509/30/15TheFlagellum0
Design 40CLOSED11/17/1212/17/12clptrsn1
Design a proteinCLOSED11/18/1012/18/10svenskhan1
design DNA?CLOSED04/29/1404/30/16kibakabul1
Design itCLOSED06/15/1206/21/14DustWitch1
Design SpaceCLOSED06/15/1206/21/14drummerdude20480
Design testCLOSED11/01/1311/30/13wisky1
design testCLOSED08/19/1308/21/13bkoep1
design testCLOSED11/27/1411/30/15ipcfg1
design your own proteinCLOSED02/13/1202/14/14mberna001
designproteinCLOSED09/20/1810/20/18pwseo1
Design_testCLOSED12/03/1412/04/14bkoep2
dhtrjkg vbuibmjjmknv n bogf bjh mknknCLOSED05/18/1105/19/14oxyi1
dhtrjkg vbuibmjjmknv n bogf bjh mknknCLOSED05/18/1105/19/14oxyi1
dhtrjkg vbuibmjjmknv n bogf bjh mknknbCLOSED05/18/1105/19/11oxyi1
di trimmer ligand versionCLOSED12/31/1505/01/16ChrisScientist1
dimer a-helix coiled-coil CLOSED11/29/1412/05/14r.gore1
dimer testCLOSED12/09/1312/15/16syoifczeri1
Dino contestCLOSED05/14/1405/15/14isabelfer2
DIY Protein (A Big One)CLOSED12/11/1512/31/15Atombryan1
Dj-P's duel puzzleCLOSED02/17/1102/18/11Dj-P1
Dog tests himselfCLOSED11/07/1111/08/11est000dog1
DONG1 proteinCLOSED10/20/1711/11/17cxlpku1
dont worryCLOSED03/24/1203/29/12billyhuegel0
DR.B JWU BIOCHEMCLOSED12/19/1202/10/13drmbudziszek0
DR.B JWU BIOCHEM Contest-HIV proteaseCLOSED01/08/1302/17/13drmbudziszek7
DrCBDmonCLOSED06/15/1406/30/14angenentmari1
drimCLOSED03/05/1403/06/14emulhall0
Drosophila Melanogaster nmd protein AAA superfamilyCLOSED02/09/1302/08/14jjwinkle47401
DSSP algorithm vs NR data baseCLOSED05/29/1206/29/12BitSpawn6
DU A-Beta puzzleCLOSED03/09/1903/18/19horowsah9
DU AB 2018CLOSED02/12/1803/12/18horowsah10
DU Chaperone 2018CLOSED01/11/1802/09/18horowsah10
DU chaperone folding puzzleCLOSED02/07/1902/15/19horowsah9
DU Enzyme 2018CLOSED01/17/1802/16/18horowsah10
DU Phosphorous 2018CLOSED01/11/1801/26/18horowsah8
DU TAR 2018CLOSED01/11/1802/02/18horowsah10
DU TAR puzzleCLOSED01/23/1902/01/19horowsah9
Dubons Class ContestCLOSED09/08/1009/10/10dubon12
DUKE TIPCLOSED06/19/1906/29/19buttmanjoe2
Duq TestCLOSED09/10/1509/11/15pink_cupcakes1
Duquesne PJAS 1CLOSED09/25/1509/27/15pink_cupcakes9
Duquesne PJAS 2CLOSED09/25/1509/27/15pink_cupcakes1
Duquesne PJAS 3CLOSED09/25/1509/27/15pink_cupcakes1
DuquesnePJAS1CLOSED09/23/1609/25/16EmilyB6
DuquesnePJAS2CLOSED09/23/1609/25/16EmilyB6
DuquesnePJAS3CLOSED09/23/1609/25/16EmilyB6
DUSP6CLOSED01/13/1802/11/18Bruno Kestemont1
DUSP6CLOSED01/13/1802/11/18Bruno Kestemont1
dyfhyh yghdrhCLOSED03/11/1503/15/15minecraft4ever41
e235wefCLOSED07/07/1307/23/16phallicies1
easronCLOSED11/16/1511/17/15EastonSickels12342
easyCLOSED10/09/1310/31/16alex900
easyCLOSED10/09/1312/31/16alex901
Easy ContestCLOSED12/12/1212/30/12haywick0
Easy DIY Protein (For more precision then the other one)CLOSED12/11/1512/31/15Atombryan2
Easy first alignmentCLOSED05/09/1105/31/11serico71
easy!!!! :o)CLOSED10/01/1012/31/13yomama0
EC Fall15CLOSED10/30/1511/15/15jcnichols1
EC Fall15CLOSED10/29/1511/15/15jcnichols14
Educurious Frizzled Design Puzzle Contest! CLOSED02/10/1303/31/13katievh51
efeliCLOSED10/11/1110/12/11chatask1
EL3 #2CLOSED03/01/1305/03/13Wilm0
ELAV4_48_118CLOSED09/28/1309/01/14Panoramix1
Elijahs contestCLOSED03/08/1303/31/13ilikediamonds2
ella introductionCLOSED09/28/1310/28/13manasa0
Ellington Biochemistry ClassCLOSED11/08/1811/13/18emkbowman6
Entamoeba insertion domainCLOSED10/06/1210/12/13lucnoken1
enzymeCLOSED03/01/1803/29/18horowsah1
Enzymology puzzleCLOSED02/17/1902/22/19horowsah4
Enzymology puzzle 2CLOSED02/18/1902/22/19horowsah8
EPD 8 BioinformaticaCLOSED04/10/1904/30/19agonriv2
erero7 challengeCLOSED02/08/1202/29/12erero70
erero7 challengeCLOSED02/08/1202/29/12erero70
erero7 challengeCLOSED02/08/1202/29/12erero70
erero7 challengeCLOSED02/08/1202/29/12erero71
Eric's TestCLOSED11/15/1611/17/16ebrenner141
erjOPEN02/12/1712/31/20ScratchKid1
ERN-TransmembranCLOSED04/29/1604/30/16zduzgun1
Erv46 KrisCLOSED07/31/1508/07/15kristoferkeiser1
etrgCLOSED03/26/1112/31/14oxyi0
etrgCLOSED03/26/1112/31/14oxyi0
etrgCLOSED03/26/1112/31/14oxyi0
evaesionCLOSED12/28/1212/31/12Evaesion0
Even simpler recipe testerCLOSED05/31/1006/30/10Datstandin1
Everyone can joinCLOSED12/03/1201/16/13junikl21
Everyone Join!CLOSED06/28/1212/24/13lakeyja900130
Exam 2 EC Spring 2015CLOSED03/27/1504/05/15jcnichols14
extended_design_tjCLOSED08/02/1208/05/12TJBrunette1
Extra credit for examCLOSED10/23/1310/31/13jcnichols37
Extracellular peptideCLOSED10/18/1710/25/17danielofs1
F20 for testingCLOSED12/24/1002/28/11Rav3n_pl8
FA18_CH410_ECCLOSED01/01/3011/08/18ProfCollins14
Facile for Italian :)CLOSED09/24/1110/24/11Vaio1
fahdkabaniCLOSED02/20/1302/21/13fahdkabani2
Family and FriendsCLOSED05/13/1305/07/16LunarEclipse1
FANTASYCLOSED01/09/1201/10/12hu74go1
Fastest personCLOSED12/13/1212/22/12ponies_rock1
fbdfnbdgnCLOSED05/23/1112/31/14oxyi1
feqfCLOSED01/21/1301/17/15jinguluninja1
ferer gergeCLOSED01/27/1301/13/16jinguluninja1
Festa Scienze 2019CLOSED06/07/1906/08/19abg-20191
Fight AIDSCLOSED12/09/1312/31/16Matthew Krueger290
Fight Liver CancerCLOSED06/12/1412/31/14retroneo1
figure it outCLOSED08/14/1408/18/14crush21121
Final ProjectCLOSED08/04/1508/31/15megskene1
find the various aminosCLOSED07/06/1012/31/10smith92clone2
fire and rainCLOSED11/20/1212/22/12mattymoe1
fire and rainCLOSED11/20/1212/22/12mattymoe1
firstCLOSED02/20/1112/31/11jojotastic7771
firstCLOSED02/25/1112/31/11alex20111
first contestCLOSED10/20/1110/21/11Robinso1
First moleculeCLOSED04/12/1304/13/13gsandoval1
First puzzleCLOSED11/29/1412/03/14r.gore1
first timeCLOSED03/24/1203/25/12billyhuegel1
FirstTryCLOSED10/15/1410/17/14Waverka.102
Flu PuzzleCLOSED10/09/1210/11/12beta_helix3
Flu Puzzle CompetitionCLOSED10/09/1210/11/12beta_helix28
Flute lets go sonCLOSED09/30/1410/01/14FluteJasonKarakaedos3
Foamy Virus Gag proteinCLOSED04/10/1204/17/12blutjoghurt1
FOLD ChampionshipCLOSED12/23/1012/31/10Dj-P1
Fold It (or else)CLOSED09/20/1009/26/10Zeff0
Fold It (or else)CLOSED09/20/1009/26/10Zeff0
fold it contestCLOSED11/29/1211/30/12ylecroy2
Fold It League Preseason ScrimmageCLOSED02/06/1502/14/15DGOVIL0
Fold it!CLOSED04/19/1606/19/16krzysztofbulenger0
Fold like the wind (blow me away)CLOSED12/11/1612/31/16kath26560
Folding conCLOSED06/16/1506/16/16zedOFF0
foldit proCLOSED10/08/1410/09/14otterballer1
Foldit tura pierwszaCLOSED05/23/1405/25/14Behoston17
Foldit University ChallengeCLOSED11/05/1011/19/10ilya.makedon47
FOlditExpoCLOSED06/06/1306/11/13ReinhardtScience11
Fomento CSCLOSED04/19/1604/29/16fomento001
For FunCLOSED02/12/1803/12/18srinaldi16561
For my studentsCLOSED03/16/1203/23/12GirichMS1
For ScienceCLOSED08/07/1509/30/15HDRH0
For stud. 2CLOSED03/18/1204/30/12GirichMS1
For stud. 3CLOSED03/18/1204/30/12GirichMS1
For studentsCLOSED03/18/1204/30/12GirichMS1
For testing purposesCLOSED03/19/1303/31/13f00barbob1
ForfCLOSED04/10/1704/11/17Leser1
Free Challenge for University StudentsCLOSED11/18/1012/18/10ilya.makedon0
free style 101CLOSED12/02/1312/25/13Jaceno9
free style 500CLOSED09/20/1010/31/10ethanIc1
Free testCLOSED07/29/1308/23/13eatfears1
FreebuildCLOSED07/18/1107/20/11e-wok4561
freebuild2CLOSED07/18/1107/20/11e-wok4561
FreedomCLOSED01/07/1201/09/12qbolt5000
FreedomCLOSED09/13/1709/14/17LilinC331
freestyleCLOSED12/06/1812/31/18xm109sr1
FREESTYLECLOSED07/21/1807/22/18aneeta0
freestyleCLOSED07/11/1509/30/15felix19980
FreestyleCLOSED08/16/1208/30/12Mytherus1
FreestyleCLOSED10/08/1210/07/13asdf98
FreestyleCLOSED09/21/1109/29/11Stano280
freestyle 20CLOSED07/25/1708/22/17PatricioBato1
freestyle 20CLOSED02/24/1502/24/16manasa1
Freestyle 20CLOSED03/17/1203/20/12upquark1
Freestyle 40CLOSED07/25/1708/24/17PatricioBato1
Freestyle 40CLOSED07/07/1507/08/15LKluke1
Freestyle 40CLOSED03/13/1403/14/14Shpooom1
Freestyle 500CLOSED06/30/1506/15/18emernic1
Freestyle 80 for a monthCLOSED06/25/1007/31/10sehskyle1
Freestyle 80 segment de-novoCLOSED04/22/1304/27/13wosser11
Freestyle 80 TrimerCLOSED11/11/1512/20/16AryehK1
Freestyle CompetitionCLOSED07/19/1107/26/11rattlesnake80
Freestyle DCCLOSED04/23/1405/28/14spearandmagichelmet1
Freestyle DesignCLOSED12/16/1512/25/15010100111111
Freestyle DesignCLOSED12/24/1112/31/11r4m3nn00dl3s0
Freestyle DesignCLOSED04/22/1204/30/14michaeled3141
Freestyle Design (80 segments)CLOSED01/13/1301/31/14OrigamiMaster1
Freestyle Design - 20 (ST - Recipe Research Channel)CLOSED06/18/1106/30/11Seagat20111
Freestyle Design - 80 (Anthropic Dreams team members)CLOSED06/17/1106/22/11Seagat20114
Freestyle Design 100 SandboxCLOSED03/06/1403/31/17viosca1
Freestyle Design 150CLOSED04/02/1504/10/15spacexplorer1
Freestyle Design 20 CLOSED05/09/1605/29/16010100111111
Freestyle Design 20 CLOSED12/16/1512/31/15010100111111
Freestyle Design 20CLOSED01/27/1501/31/18HerobrinesArmy1
Freestyle design 20CLOSED10/09/1210/09/14meatexplosion1
Freestyle Design 20CLOSED07/12/1307/12/16Sadler1
Freestyle Design 20CLOSED02/08/1602/29/16010100111111
Freestyle Design 20OPEN03/02/1601/01/30khendarg1
Freestyle Design 200 CLOSED01/11/1601/01/17010100111111
Freestyle Design 40CLOSED07/28/1508/01/15the wheat thin1
Freestyle Design 40CLOSED01/27/1501/31/18HerobrinesArmy1
Freestyle design 40CLOSED10/09/1210/09/14meatexplosion1
Freestyle Design 40CLOSED01/30/1512/31/15Hutty1
freestyle design 40CLOSED02/27/1903/04/19jguerra51
Freestyle Design 40CLOSED07/12/1307/12/16Sadler1
Freestyle Design 40OPEN03/02/1611/23/21khendarg1
Freestyle Design 40 Contest #1CLOSED03/06/1703/13/17FutureScientist12121
Freestyle design 40 pcCLOSED08/17/1409/17/14Serraglio0
Freestyle Design 40: For Learning LUACLOSED06/24/1206/30/15gitwut.lua1
Freestyle Design 500 CLOSED01/11/1601/31/16010100111111
Freestyle Design 500 CLOSED04/28/1105/31/11Acida-24
Freestyle Design 500CLOSED12/09/1012/12/10MHannigan1
Freestyle Design 500CLOSED11/21/1211/22/12Daileyc0
Freestyle Design 500CLOSED10/16/1111/06/11ofc20001
Freestyle Design 500CLOSED04/16/1204/29/12drumpeter18yrs9yrs2
Freestyle Design 500CLOSED06/15/1506/22/15pipos11
Freestyle Design 80CLOSED05/03/1305/18/13iqbalmahmud1
Freestyle Design 80CLOSED10/17/1010/01/11BlueRabit1
Freestyle Design 80OPEN09/15/1309/15/20Sadler1
Freestyle Design 80CLOSED04/13/1304/20/13JamesLeCornu0
Freestyle Design 80CLOSED08/21/1010/31/10Handful1
Freestyle Design 80CLOSED03/19/1403/20/14thoyt20121
Freestyle Design 80CLOSED01/31/1202/09/12kimdn1
Freestyle Design 80CLOSED03/24/1209/30/12ofc20001
Freestyle Design 80 Contest #2CLOSED03/13/1703/20/17FutureScientist12121
Freestyle Design a 500 length Protein!CLOSED12/09/1312/31/16Matthew Krueger43
Freestyle Design CompetitionCLOSED06/20/1106/30/11Dinoclor1
Freestyle Design this 500 residue protein - Seagat2011CLOSED12/17/1001/14/12Seagat201150
Freestyle Design Variable LengthCLOSED01/09/1101/01/12ten040319771
Freestyle Design Variable Length. 2 weeksCLOSED04/09/1304/24/13MurloW1
Freestyle Design: Variable LengthCLOSED05/02/1305/10/13ligandfinder1
Freestyle Design: Variable LengthCLOSED08/16/1808/31/18Uttkarsh1
Freestyle Design: Variable LengthCLOSED04/28/1105/31/11Acida-21
Freestyle Design: Variable LengthCLOSED05/10/1805/11/18ac2812011
Freestyle for allCLOSED11/01/1012/05/10thosi3
freestyle funCLOSED09/26/1212/31/12saggyballs1
Freestyle Multi-start 499.9CLOSED12/22/1001/01/11Dj-P1
Freestyle RRM CLOSED04/22/1611/29/16obiwan0
Freestyle RRM CLOSED04/22/1611/29/16obiwan0
Freestyle SimpleCLOSED08/19/1108/21/14WheelerLovett0
Freestyle SimpleCLOSED08/19/1108/21/14WheelerLovett1
Freestyle Symmetric Design: 40 DimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 40 TrimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 80 DimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 80 TrimerCLOSED04/04/1404/11/14test_account10
Freestyle Symmetric Design: 80 TrimerCLOSED01/15/1601/31/16010100111111
freestyle synthetic protein designsCLOSED06/12/1707/12/17jigs1
freestyle testCLOSED10/27/1210/28/12Marek_Berlin1
Freestyle Variable Length. 1 month. CLOSED02/26/1303/25/13MurloW8
Freestyle VarLengthCLOSED06/08/1406/30/14Bithalbierer1
Freestyle!!!CLOSED01/11/1201/12/12adele210
Freestyle150CLOSED01/30/1501/30/17queentut161
FreestyleBKGCLOSED12/22/1012/31/13aricc1
Frestyle contestCLOSED10/04/1710/08/17maximiliancarey1
frezaeCLOSED07/18/1408/31/14frezae0
FrizzleCLOSED12/02/1203/02/13marie_s1
FrizzledCLOSED03/21/1303/23/13beta_helix1
FRIZZLED DESIGNCLOSED07/01/1907/31/19helen883
Frizzled Design because we are boredCLOSED01/24/1301/27/13jamiexq17
Frizzled Design ContestCLOSED11/30/1412/06/14ingoneato14
Frizzled Design Puzzle ContestCLOSED02/11/1512/31/18michaeled31442
Frizzled Design Puzzle Contest - October PD CLOSED10/25/1211/01/12katievh1
Frizzled testCLOSED05/16/1405/24/14fankong1
FrizztestCLOSED08/20/1308/31/13spmm1
FTN1438CLOSED12/19/1212/31/13nwabu1ao1
FunCLOSED12/12/1012/31/10bost291
funCLOSED11/21/1312/31/16ninjaeliot1
FUN! FUN!CLOSED11/17/1211/30/15alexkarate0
FunnyCLOSED02/01/1404/06/14Spark61
G-quadruplexCLOSED03/14/1503/02/16kapick840
Gaming For Research EventCLOSED11/27/1811/28/18walid.alitani28
GCN-4 BipyCLOSED10/14/1510/16/15LiamMarshall0
GeneDesignCLOSED03/08/1804/07/18chingsong55
GeneDesign2ndCLOSED07/12/1807/29/18chingsong1
GeneEngineeringCLOSED05/16/1706/15/17chingsong68
GFPCLOSED10/18/1010/30/10Pyrohmstr1
GFPCLOSED10/18/1010/30/10Pyrohmstr0
GFP1CLOSED10/18/1010/30/10Pyrohmstr1
GingivitisCLOSED04/30/1905/30/19Aminal881
Giordano's ClassCLOSED09/09/1009/13/10cgiordano0
GlobalCLOSED12/16/1712/17/17ckluo2
Go freestyle!CLOSED04/15/1204/22/12AsDawnBreaks1
go with the flowCLOSED12/23/1212/30/12Npereira1
Go with the flow 2CLOSED12/23/1212/30/12Npereira1
god berryCLOSED02/18/1103/12/11My Cranky Panda1
Golden GooseCLOSED01/29/1401/30/14Maverik_Goose0
good luckCLOSED03/24/1203/25/12billyhuegel1
Governors Academy Freestylin'CLOSED12/02/1112/04/11conorodea1111
GOVST BIOCHEMISTRYCLOSED05/07/1212/17/12govstbiochem1
GPCR TestCLOSED10/09/1310/03/14alathb1
Grand master rival challengeCLOSED01/01/1112/31/11Malzarg0
GRC demoCLOSED06/17/1906/22/19horowsah1
Greek Key 3.0CLOSED03/28/1904/27/19jakelmer1
Greek Key ChallengeCLOSED01/25/1502/10/15jakelmer12
Greek Key TestCLOSED02/11/1503/11/15kirkngrant1
Greek Key Test RunCLOSED02/11/1503/11/15kirkngrant0
Greek Key V2.0CLOSED03/30/1504/15/15jakelmer3
groelCLOSED03/01/1803/29/18horowsah1
Group V Biophysics BITSGCLOSED02/09/1605/16/16SandyVii1
GTPaseCLOSED06/02/1609/15/16yjguo_100
GTPaseCLOSED07/11/1008/31/10Jordandk1
GTPase pas puzzleCLOSED09/14/1212/31/12SOARcdur1
GTPase RasCLOSED09/23/1110/07/11Miah2
GTPase RasCLOSED06/19/1307/20/13ChinaSESsolve1
GTPase RasCLOSED05/15/1305/31/13Ninty90
GTPase Ras CLOSED09/16/1612/08/16hgenzman211
GTPase RasCLOSED08/18/1008/31/10cyclic31
GTPase RasCLOSED09/10/1109/01/12glenwayguy1
GTPase RasCLOSED10/19/1103/18/12wangyueyun1
GTPase RasCLOSED11/23/1212/28/12ridesisapis0
GTPase RasCLOSED11/25/1112/31/11O Seki To0
GTPase RasCLOSED11/10/1311/10/14MyFines0
gtpase rasCLOSED02/09/1302/01/15jjwinkle47401
GTPase Ras 1.0CLOSED12/23/1012/31/10Dj-P1
GTPase Ras FoldCLOSED06/25/1507/01/15BlockheadXX0
GTPase Ras Long b [Open to all] [Open discussion]CLOSED01/28/1412/31/17AsDawnBreaks169
GTPase Ras testCLOSED02/29/1204/30/12oshirikajirimushi18th1
Guanlin_HUSTCLOSED07/03/1507/03/16Guanlinli1
guanzhuangCLOSED12/19/1801/18/19chingsong32
H3 Hemagglutinin Flu Design PuzzleCLOSED02/01/1202/03/12beta_helix4
hahhaaha cool.CLOSED11/19/1211/23/12joshlitchman1
Halobacterium NRC-1 Hypothetical ProteinCLOSED01/08/1105/31/11pramodbhat1
HalorhodopsinCLOSED02/18/1202/26/12MnSOD0
hankg10CLOSED07/28/1407/29/14hankg101
HansDampfCLOSED02/28/1305/03/13Wilm0
HappierCLOSED09/30/1509/30/18ferricst81
hardCLOSED11/13/1012/31/10marshin1
ha_testCLOSED05/22/1905/31/19bkoep2
HbA1 TestCLOSED03/11/1503/12/15minecraft4ever40
HBA1 TestCLOSED03/11/1503/13/15minecraft4ever41
HBA1 Test2CLOSED03/11/1503/12/15minecraft4ever41
HBMCLOSED04/12/1507/26/15ChrisScientist1
HBV core proteinCLOSED03/14/1303/15/13Tsogo0
HBV core proteinCLOSED03/14/1303/23/13Tsogo1
Heather and Nate CLOSED05/16/1805/17/18heatherlapier1
Heather and Nate Round 2 CLOSED05/16/1805/17/18heatherlapier2
Heather and Nate Round 3 LOL CLOSED05/16/1805/17/18heatherlapier2
HelCLOSED05/19/1505/19/19ivalnic1
helixCLOSED12/09/1412/31/15ivalnic1
HelixCLOSED05/13/1505/15/15dendixon0
helix testCLOSED05/18/1505/27/15dendixon1
hello worldOPEN01/01/3009/17/19shan111
Help Cure HIVCLOSED09/05/1609/30/16Toyo1
helphaverCLOSED07/21/1807/24/18korinnac0
Hemagglutinin BinderCLOSED07/12/1907/19/19bkoep4
Hemagglutinin Binder DesignCLOSED06/13/1906/20/19bkoep10
Hemagglutinin Binder DesignCLOSED07/02/1907/09/19bkoep2
hemoglobin checkCLOSED11/26/1111/30/11Rellis1
Here we goCLOSED07/14/1507/18/15Unwise1
Hexaguin's Freestyle 80CLOSED01/22/1201/31/12hexaguin1
hiCLOSED02/17/1202/29/12cyrusi1
hi2CLOSED02/18/1203/01/12cyrusi1
Highest scoreCLOSED07/07/1312/25/13dbuske0
Histone H1CLOSED01/03/1101/31/11Dj-P4
HIVCLOSED01/07/1202/11/12fallenspartan1
HivCLOSED12/07/1412/01/15dbuske4
HIVCLOSED09/15/1309/29/13trueplayer0
HIVCLOSED03/01/1803/29/18horowsah1
hivCLOSED04/08/1904/30/19dbuske1
HIVCLOSED12/20/1101/31/12Chappers7
HIVCLOSED09/26/1309/24/16ScoobyHusky1
HIVCLOSED08/15/1406/30/15Test Lab1
hivCLOSED11/12/1001/16/11marshin1
HIVCLOSED12/05/1212/29/12Quxwozing1
HIV Crash testCLOSED12/21/1012/31/11Dr Tyrell1
HIV attackCLOSED06/05/1106/30/12Overlord131
HIV challengeCLOSED10/09/1110/30/11ofc20000
HIV fight!CLOSED08/22/1008/31/10Rav3n_pl29
hiv positiveCLOSED10/03/1310/04/13Mhembrough1
HIV ProteaseCLOSED09/01/1309/28/13Gamerrr1110
HIV ProteaseCLOSED03/05/1203/01/13dbuske1
HIV proteaseCLOSED09/17/1009/18/10skoddet120
HIV proteaseCLOSED01/16/1201/17/12recondite70
HIV proteaseCLOSED01/16/1201/20/12recondite72
HIV proteaseCLOSED03/05/1303/26/13alex8090100
HIV proteaseCLOSED07/09/1207/31/12drumpeter18yrs9yrs0
hiv proteaseCLOSED07/11/1007/17/10asianboy261
HIV ProteaseCLOSED01/21/1203/03/12recondite7159
HIV PROTEASECLOSED01/18/1702/01/17gu140010
HIV proteaseCLOSED10/17/1110/22/11Joshua Algode1
HIV proteaseCLOSED01/02/1101/01/12maksimlekler1
HIV proteaseCLOSED01/25/1201/31/12docfon1
hiv proteaseCLOSED10/19/1110/19/12jerrywhite131
HIV proteaseCLOSED01/09/1112/31/14Alegend451
HIV proteaseCLOSED03/27/1404/04/14Professor West11
HIV ProteaseCLOSED03/16/1606/01/16CureForDiabetes1
HIV protease - BIOL225CLOSED01/16/1401/22/14Kimbostu6
HIV Protease - BIOL225CLOSED01/22/1501/29/15Siderhurst11
HIV protease - BIOL225CLOSED01/28/1602/04/16Siderhurst11
HIV protease BKCLOSED06/10/1506/11/15bkoep1
HIV protease contestCLOSED12/04/1412/07/14DrewNyeTheScienceGuy0
HIV protease contest!CLOSED05/29/1105/31/11chouti1
HIV Protease FoldingCLOSED05/10/1705/13/17Komsomolez6
HIV protease newCLOSED09/29/1110/31/11davidpat1
HIV protease sandboxCLOSED05/04/1105/01/14tyler091149
HIV protease testCLOSED03/01/1205/01/12oshirikajirimushi18th1
HIV solversCLOSED12/31/1504/01/16Sammie1231
HIV stinks.... yeah yeahCLOSED05/12/1205/01/14tweak641
HIV testCLOSED04/11/1204/13/12SciShowFTW1
HIV TroubleCLOSED09/18/1709/30/17LOGOLOZ1
HiV tryCLOSED08/20/1009/20/10Pyotr1
HIV's end CLOSED02/13/1112/31/14Dj-P305
hjjjjjjjjjjjjjjjjjjCLOSED12/20/1112/31/14oxyi1
hmCLOSED04/07/1304/09/13MurloW1
hmmCLOSED04/07/1304/09/13MurloW1
hnvfcfhncfh kbkkkhCLOSED06/15/1112/31/14oxyi1
HolotoxinCLOSED02/03/1202/06/12Erik.dover0
Homology Modeling Course: HIV ProteaseCLOSED06/12/1206/15/12obiwan7
Homology_Praktikum_IBK_SS11CLOSED06/16/1106/20/11csac19599
hotuCLOSED11/12/1011/30/10marshin1
Human NeuritinCLOSED01/25/1802/24/18Topo241
Human Respiratory Syncytial Virus Attachment Protein (RSV G)CLOSED04/12/1207/31/12MiCu1
Hypotethical Protein ATU0225CLOSED10/21/1410/09/15gorrila131
iCLOSED01/27/1701/30/17zduzgun1
I Dare You!!!CLOSED01/09/1501/10/15nakul_07020
i-motif DNA structureCLOSED08/01/1308/31/13csjonline0
IBG2CLOSED11/23/1811/24/18ujehn1
Ice-structuring proteinCLOSED02/01/1602/29/16Tajuton_potilas21
Immunoglobulin D Hinge H1CLOSED08/06/1408/17/14frogzorz0
indi 500 segment raceCLOSED05/17/1412/31/17jeshprabakaran1
indoor soccer shoes adidas f50CLOSED07/24/1307/26/13Clarisonic1230
Inhibitor design vs a-synCLOSED10/03/1810/31/18SleepyPanda1231
InsulinCLOSED07/14/1507/18/15Unwise0
intracellular Caspase-Modulating Chimeric Antigen ReceptorCLOSED07/17/1207/17/14starone0
Investigate Inspect TestCLOSED08/20/1308/21/13NickyCGS3
invite onlyCLOSED12/04/1512/04/16vkalas1
IQS protein folding contest 2014CLOSED03/17/1403/31/14xevi.biarnes1
iRFPOPEN02/13/1702/13/20amao11
iRFP 2OPEN02/13/1702/13/20amao11
ISHMIT DAHALCLOSED03/18/1303/19/13USER20131
ismailhakkiakgunCLOSED10/19/1610/24/16ismailhakkiakgun1
Itfs-2019CLOSED04/30/1905/09/19ITFS20191
IVa2CLOSED11/03/1412/20/14paul.kascak1
IVa2CLOSED11/14/1411/30/14paul.kascak1
IVa2CLOSED11/23/1411/07/15paul.kascak1
jCLOSED09/30/1110/01/11klixovann0
jhdfksaufsahkmdCLOSED02/28/1403/02/14spider8762
JJJP bmi206 foldCLOSED11/07/1111/30/11Peter20000
JJT twincomboCLOSED11/30/1501/31/16Canadian KId2
jnkljnklhjnljnljnlCLOSED12/04/1112/31/11oxyi1
jnkljnklhjnljnljnlCLOSED12/04/1112/31/11oxyi0
JOINCLOSED07/01/1908/01/19helen885
Join if u DareCLOSED04/26/1304/20/14srgp20125
jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujujuCLOSED12/24/1112/31/14oxyi1
Just 4 funCLOSED07/12/1207/20/12Josephdud661
Just a puzzleCLOSED07/01/1307/31/13wisky1
just do itCLOSED10/30/1112/31/11pokemon.guy0
Just For BegginersCLOSED04/29/1504/30/15timothyu1201
Just For FunCLOSED01/26/1201/27/12Metadryad1
Just for testCLOSED09/06/1209/07/12dyh1
Just playing aroundCLOSED03/13/1203/20/12wdherndon1
kanyaCLOSED10/14/1010/26/10g53144016731
KennyCLOSED10/26/1201/01/13kennyhill0
khc headCLOSED04/13/1104/20/13ceventer0
khc testCLOSED10/14/1010/14/11ceventer1
khfchlk 1CLOSED02/23/1202/24/12Solenopsis invicta1
killenCLOSED04/23/1504/24/15woops7
King of the ClassCLOSED12/10/1512/11/15crostomily6
kk's contestCLOSED04/20/1104/30/11kkwizard1011
Knotfind onCLOSED12/10/1112/31/11beta_helix6
KnotsCLOSED05/22/1205/23/12AsDawnBreaks1
KumamolisinCLOSED06/13/1207/31/15drummerdude2041
l1CLOSED07/05/1907/31/19lnq1
l2pmikeCLOSED09/24/1209/25/12OppaProteinStyleZ0
l2pmikeCLOSED09/24/1209/25/12OppaProteinStyleZ0
Lab SequenceCLOSED10/16/1310/01/14Orangeutan1
Lac repressorCLOSED05/17/1605/24/16dunawayjacob1
LaccaseCLOSED01/19/1101/23/11El_Crazy_Xabi1
Large Protein TestCLOSED12/14/1012/15/10Gray Thomas1
LASA OctagonCLOSED02/07/1302/10/13JosephOleniczak0
Lastest contest against the cancerCLOSED03/30/1212/31/15Dj-P105
laura testCLOSED08/23/1108/24/11laurabee1
laura test2CLOSED08/23/1108/24/11laurabee1
Laurabee's puzzleCLOSED07/13/1107/14/11laurabee0
Leishmania donovani Ornithine decarboxylaseCLOSED11/20/1511/25/15mikroplasma2
Let's Cure Cancer FinallyCLOSED08/18/1012/31/13mikedressner691
Let's go!!!!CLOSED04/28/1212/12/12wendy_rupnow0
Let's go!!!!CLOSED04/28/1212/12/12wendy_rupnow0
Let's have fun.CLOSED07/25/1108/02/11etety331
Lets have funCLOSED01/11/1501/13/15imenm3
LETSGOCLOSED08/26/1108/27/11wudoo4
leukaemia virus chain native matrixCLOSED02/01/1208/27/12GoshaDole1
ligamazeCLOSED12/31/1503/31/16ChrisScientist1
ligan practice -open to allCLOSED03/21/1203/31/12Mike Tate3
Ligand Folding Practice- Open to allCLOSED05/01/1109/01/11tyler091123
Ligand PracticeCLOSED05/24/1109/11/11tyler09113
Ligand PracticeCLOSED12/07/1312/16/13slofgren1
ligand testCLOSED02/13/1402/12/15syoifczeri1
lilovip-tests-02CLOSED08/05/1508/31/18lilovip1
lilovip01CLOSED06/22/1407/22/14lilovip1
Lindert OSC DayCLOSED06/20/1806/22/18bowman13342
linkerCLOSED04/11/1504/30/15463418196@qq.com1
lms friendsCLOSED12/03/1212/04/12johncb30
Loci's new test contestCLOSED03/08/1904/07/19LociOiling1
Loci's seal myoglobin testCLOSED11/12/1811/19/18LociOiling2
Loci's T0743 contestCLOSED11/12/1811/19/18LociOiling1
Loci's test contest testCLOSED05/21/1805/22/18LociOiling1
Loci's test contest testCLOSED10/28/1810/30/18LociOiling0
Loci's variable length design contestCLOSED07/03/1807/31/18LociOiling3
LOL FU CLOSED09/30/1610/30/16BroC41
Lol tuturialCLOSED02/20/1802/21/18danielvan19943
Long ContestCLOSED09/20/1001/01/12maquiladora1
Long linksCLOSED04/21/1204/30/12AsDawnBreaks6
Loss CancerCLOSED08/31/1012/31/10FalconDeOro1
lost points test caseCLOSED03/26/1412/25/14brgreening1
lost points test twoCLOSED04/25/1404/25/17brgreening1
love vs. loveCLOSED02/22/1202/24/12k.love2
LOX enzyme from humanCLOSED05/21/1312/24/13magnus groes1
LPDF ContestCLOSED04/30/1205/03/12maxionwimps1
LUA testCLOSED01/05/1101/30/11Dj-P1
lv.1 CLOSED03/28/1104/03/11Marco Chan1
MCLOSED07/05/1007/31/13RoboMonkey1
m,jb ghjCLOSED06/15/1112/31/14oxyi0
m,jb ghjCLOSED06/15/1112/31/14oxyi1
Mad hatterCLOSED01/17/1301/18/13EmperorSupreme0
Make a Greek KeyCLOSED01/27/1502/10/15jakelmer0
Malaria PuzzleCLOSED10/09/1210/11/12beta_helix3
mannersCLOSED12/21/1302/28/14Spark51
MarcusCLOSED05/17/1205/20/12mdaquino1
marolidas sandboxCLOSED11/20/1211/27/12marolidas1
Martin's foldfestCLOSED09/05/1809/06/18sanmartin2
Mat testCLOSED03/20/1203/20/13mat7471
math modelingCLOSED07/16/1007/29/12themarquis1
MC&SDRocksCLOSED02/27/1702/24/18SunSalutation2
McCallie AP BiologyCLOSED09/07/1309/11/13mccallieapbiology0
me and freindsCLOSED11/05/1711/07/17Nusayr1
Mean, lean, crumple machineCLOSED02/20/1406/22/14mind_hack1
MedChem14CLOSED10/16/1410/27/14pedrofong3
MediumFREE STYLECLOSED08/23/1108/31/14WheelerLovett0
MediumFREE STYLECLOSED08/23/1108/31/14WheelerLovett1
mehCLOSED10/17/1010/31/10anthunk1
Membrane receptorCLOSED12/20/1202/28/13ScottNDean1
Merry post-christmasCLOSED12/25/1512/28/15-x-1
MetallothioneinCLOSED11/05/1211/30/12Phil.Pa1
MGC - 2017CLOSED01/18/1701/24/17Kimbostu7
MGC 2014CLOSED01/16/1401/22/14Kimbostu1
MGC 2019 - GTPase RASCLOSED01/31/1902/06/19Ms Jackson1
MGC 2019 - HIV proteaseCLOSED01/31/1902/06/19Ms Jackson1
Miami UniversityCLOSED02/18/1602/21/16dirk411
MichaelCLOSED04/26/1504/28/16jinxed2
Michael and MarcoCLOSED10/05/1110/06/11bigbanggd4100
Michael and MarcoCLOSED10/05/1110/06/11bigbanggd4100
Michael and MarcoCLOSED10/05/1110/06/11bigbanggd4102
mine sillyCLOSED01/17/1112/31/11anthunk1
Miniprotein1L2YCLOSED04/23/1705/23/17Bruno Kestemont4
Miso try 2CLOSED10/14/1410/01/17asmidler1
Miso: a critical protein for mosquito reproductionCLOSED10/14/1410/01/16asmidler1
missing side chainsCLOSED01/24/1402/23/14apoma0
Moar Freestyle Design. 80 seg, 1 weekCLOSED03/26/1304/02/13MurloW2
MoeCLOSED07/22/1808/20/18ivalnic1
MoeCLOSED10/21/1510/01/16ivalnic1
Moloney Murine Leukaemia Virus Matrix Protein CLOSED02/14/1205/15/12Ch Garnier29
Moloney Murine Leukaemia Virus Matrix Protein CLOSED02/01/1202/03/12beta_helix4
Monkeys Rock Ham jhhh hhhhhhhhhCLOSED12/04/1212/30/12NathanGotSkills230
MonooxygenaseCLOSED03/10/1204/30/12hansfoldit0
MontcrestCLOSED12/20/1101/31/12Chappers3
MontcrestCLOSED12/20/1101/31/12Chappers1
Montcrest for realCLOSED12/20/1101/31/12Chappers1
more testingCLOSED05/04/1112/31/14anthunk1
more thunk testingCLOSED03/29/1206/30/12anthunk9
motor protein tailCLOSED08/23/1008/23/11ceventer1
MPICLOSED10/31/1311/30/13Mengzzz19
Mr Faure 1v1 me lmao 100XDDDDDDDDDDDCLOSED11/14/1711/15/17B0B05
Mr Ma No. OneCLOSED07/29/1107/29/14mayumiao1
Mr Ma No.1CLOSED07/27/1107/31/12mayumiao1
MRMAND123CLOSED11/09/1111/09/12MR MAN D1
mTORCLOSED02/23/1502/23/18kurenan1
Multi-domain proteinCLOSED04/10/1307/10/13pbartlow1
Multi-histidine and Glutamate sequence complexed with Mn(II)CLOSED09/26/1110/10/11masspeana1
Multi-Start Bacteroides Vulgatus Contest CLOSED10/13/1204/13/13Ch Garnier17
mutate_testCLOSED02/25/1404/25/14robgee1
mva1alphaCLOSED09/22/1009/21/11mvackel1
My 500 TestCLOSED01/17/1402/24/14BCAA1
my bio info assinment version 2CLOSED01/17/1502/01/15c0d3w4rri0r1
my bioinfo assinmentCLOSED01/17/1502/12/15c0d3w4rri0r1
My ContestCLOSED11/04/1611/05/16Benbennett20003
my contestCLOSED09/20/1112/20/11Lysergic cure1
my contestCLOSED10/01/1610/30/16Carlos Santamaria1
my contestCLOSED09/01/1009/02/10marissa1010
My first contestCLOSED09/14/1209/30/12SOARcdur1
My first contestCLOSED10/26/1110/31/11awesome41321
My first contest))CLOSED11/01/1311/07/13krytoy10
my freestyle trialCLOSED12/20/1112/27/11Niubilism1
MyoglobinCLOSED06/08/1406/15/14Bithalbierer1
myoglobinCLOSED01/22/1201/26/12vacmar1
MyoglobinCLOSED11/30/1112/23/11Ronald Wichman0
N-GlnRCLOSED06/09/1209/30/12weihuachen52111
name 150CLOSED01/02/1801/19/18010100111111
name 2CLOSED01/01/1801/20/18010100111111
name 500CLOSED01/01/1801/20/18010100111111
name nameCLOSED01/01/1801/05/18010100111111
nanobodyCLOSED07/09/1808/07/18Bogdan Barnych1
nanogCLOSED07/17/1407/24/14oli-popxD1
Nanog Homeobox Protein (NANOG)CLOSED03/07/1203/07/13Ch Garnier34
Nanog Transcription FactorCLOSED02/11/1512/31/18michaeled31481
Nanog Transcription factor contestCLOSED07/29/1407/31/14kaurg3
Nanog Transcription Factor Contest - CampBIOmedCLOSED07/15/1407/16/14kaurg10
NCCS weeaboosCLOSED12/07/1712/08/17sushiboi0
NCCS weeaboosCLOSED12/07/1712/08/17sushiboi0
NEAR contestCLOSED09/27/1309/29/13nyla121
Need structureCLOSED09/29/1010/10/10canikickit491
New City Charter School CLOSED12/09/1712/10/17caitlin@newcitycharterschool.org43
New City Science CLOSED12/09/1712/10/17caitlin@newcitycharterschool.org0
New small testCLOSED06/17/1007/30/10Crashguard3034
new testCLOSED06/03/1406/04/14test_account11
New_contestCLOSED11/07/1412/09/14pedrofong0
New_contestCLOSED11/07/1412/09/14pedrofong14
niepCLOSED10/24/1010/26/10niep03291
nmd AAA ATPaseCLOSED02/09/1302/08/14jjwinkle47409
No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein. CLOSED06/01/1206/30/12phi1646
No. 4.CLOSED03/18/1204/30/12GirichMS1
No. 5CLOSED03/18/1204/30/12GirichMS1
No. 6CLOSED03/18/1204/30/12GirichMS1
Noc Biologow 2018 WB UWCLOSED01/12/1801/13/18decu13
Noc Biologów 2019CLOSED01/11/1901/12/19decu15
Noc Biologów testCLOSED01/09/1801/12/18decu1
normal contestCLOSED02/04/1502/05/15deephama0011
Oakwood Honors Bio ContestCLOSED09/17/1509/30/15elightrake1
Obliged to try that!CLOSED12/01/1302/28/14Gabs_the_lil_protein1
ofc2000's tough challenge (open)CLOSED10/29/1110/31/11ofc20001
One day challengeCLOSED11/04/1111/05/11scienceschmoo0
One day challengeCLOSED11/04/1111/05/11scienceschmoo1
One last CASP9 Target!CLOSED08/25/1009/28/10beta_helix74
Open 500 Segment design puzzle CLOSED09/09/1212/31/15Ryanfav49
Open Design TestCLOSED10/18/1310/19/13picklion1
Open University ChallengeCLOSED11/20/1012/18/10ilya.makedon2
ORMDL3CLOSED07/04/1907/09/19Michal931
ORMDL3CLOSED07/03/1907/17/19Michal931
Other receptorCLOSED12/20/1212/14/13ScottNDean1
Otter GangCLOSED01/15/1901/16/19CB19Tuck0
outer envelope protein 80 [Arabidopsis thaliana]CLOSED11/12/1501/05/16swimbug20140
outer envelope protein 80 [Arabidopsis thaliana]CLOSED11/11/1501/06/16swimbug20141
owenCLOSED01/13/1401/20/14owen9o9300
P16C8UCLOSED02/01/1902/08/19obedes1
P1a1bCLOSED10/22/1010/21/11mvackel1
P22-NCLOSED04/23/1304/27/13syoifczeri1
P22-N^W[Tb]CLOSED04/23/1304/30/13syoifczeri1
P98CLOSED04/23/1504/30/16hphilipp1
PA1955_RepeatCLOSED11/10/1112/23/11MadsTS1
Pace Academy 2014 HIV proteaseCLOSED08/21/1312/21/13thattori37
Pass the ThymeCLOSED01/09/1102/28/11TheGUmmer1
PdB24CLOSED11/05/1002/01/11PdB240
PdB24CLOSED11/05/1002/01/11PdB241
pechi demoCLOSED03/03/1306/07/13anthunk2
Pedobacter Beta BarrelCLOSED12/14/1012/25/10Gray Thomas1
Penn State Hershey BMS 504CLOSED10/15/1210/28/12iropson1
Penn State Hershey BMS 504 Contest 2CLOSED10/15/1210/28/12iropson27
peptide testCLOSED05/31/1305/17/14syoifczeri1
Peptides to designCLOSED07/26/1501/01/16Brabrax0
PETaseOPEN08/26/1909/23/19RestrictionEndoNykolease1
PETase 1OPEN08/26/1909/23/19RestrictionEndoNykolease1
PETase MutantsOPEN08/23/1909/21/19RestrictionEndoNykolease1
peter and kimCLOSED02/03/1604/02/16petetrig1
peter and kimCLOSED02/03/1606/11/16petetrig1
PfTLPCLOSED07/16/1307/16/14BNGSTE0011
PFV GagCLOSED04/17/1207/17/12blutjoghurt1
PhAlpha1BetaCLOSED09/12/1009/13/10mvackel1
PhAlpha1BetaCLOSED09/12/1009/15/10mvackel1
Phalpha1betaCLOSED08/14/1008/15/10mvackel1
phosphateCLOSED03/01/1803/29/18horowsah2
phospholipase A2 from mamushi snake venomCLOSED01/11/1201/26/12gurimmer0
PitACLOSED07/16/1308/10/13canthony91
PM_1CLOSED01/17/1801/27/18PM_KSienkiewicz0
PM_2CLOSED01/18/1801/27/18PM_KSienkiewicz5
PM_PEGAZCLOSED03/20/1803/31/18PM_KSienkiewicz11
PODXLCLOSED08/04/1108/26/11machoo1
Polish ContestCLOSED11/20/1112/20/11Mojzesz4
PoliteCLOSED12/21/1304/25/14Spark52
polyVC1OPEN09/25/1809/25/19bkoep4
polyVC2OPEN09/26/1809/26/19bkoep2
polyVF1OPEN09/26/1809/26/19bkoep2
polyVF2OPEN09/26/1809/26/19bkoep2
polyVZ1OPEN09/26/1809/26/19bkoep2
polyVZ2OPEN09/26/1809/26/19bkoep2
popopopCLOSED12/28/1312/31/13swl20131
PorinCLOSED02/27/1503/02/15Jonathan511
Practice ContestCLOSED12/10/1512/11/15crostomily8
Practice for HIV ProteaseCLOSED10/28/1811/20/18DaedalusLabs1
Practice Space--FREESTYLE: VARIABLE LENGTHCLOSED11/24/1611/21/18Puttering1
Practice Space--SEAL MYOGLOBINCLOSED11/24/1611/21/18Puttering1
PRACTICE TEST 1CLOSED12/08/1512/09/15seantan3
PRACTICE TEST 2CLOSED12/08/1512/09/15seantan3
Practice_folding_from_scratchCLOSED08/22/1612/01/16Miguel.alj3901
pranavCLOSED01/28/1801/29/18pranavchels0
pranavtestCLOSED03/15/1803/16/18pranavchels0
Pregnancy Associated Plasma Protein (PAPP-A)CLOSED03/12/1108/15/11meschruhms1
prejudice on HIVCLOSED06/13/1412/16/14manasa1
Private ContestCLOSED10/21/1310/23/13theOMGmonster0
Private ContestCLOSED02/27/1502/28/16babacon1
Private Whitcon CLOSED06/21/1906/24/19prolylendopeptidase7
progesterone reductaseCLOSED10/25/1310/25/14sarahoconnor0
protein 3AB [Enterovirus C]CLOSED03/08/1505/08/15orangejayo11
Protein ContestCLOSED04/25/1212/31/12Dave Levine0
protein desgin CLOSED06/11/1306/14/13ctdevlin1
Protein Folding with Point mutationsCLOSED07/28/1506/16/18emernic1
Protein LaboratoryCLOSED12/10/1312/25/13slofgren1
Protein StabilityCLOSED05/31/1612/31/16Alisa Southerncross0
protein to test scriptsCLOSED05/22/1012/31/10smith92clone1
provaCLOSED01/08/1201/17/12hu74go1
ProvaCLOSED08/03/1908/04/19ikemori2
Prova 2CLOSED08/10/1908/15/19ikemori1
Prova mioglobinaCLOSED07/17/1907/18/19marcodabramo1
prueba 1xCLOSED10/22/1011/11/10rascuacho0
prueba mioglobinaCLOSED06/30/1306/11/14cmendo1
Pseudomonas aeruginosa PA4063CLOSED02/28/1603/31/16mutinus1
Putative Plant ProteinCLOSED10/10/1410/31/14Mecklenburger Friese1
QQCLOSED06/21/1707/20/17416074311
Quick & Dirty KnotFindCLOSED12/25/1101/03/12Vincero1
Quinoa TestCLOSED07/09/1507/31/15dinoboy111
R3CLOSED01/29/1401/30/14maverickandgoose1
Raf kinase inhibitorCLOSED03/07/1403/30/14pongoo1
raidCLOSED10/19/1610/20/16TheEnderCavalier1
raid 2CLOSED10/20/1610/21/16TheEnderCavalier1
Raid 3CLOSED10/21/1610/22/16TheEnderCavalier0
RandomCLOSED01/28/1201/31/12dabanks1
Random PuzzleCLOSED08/03/1108/04/11Mp09070
Random PuzzleCLOSED08/03/1108/04/11Mp09071
random testCLOSED10/12/1012/31/10Ryanfav1
rc013CLOSED05/09/1205/31/12jlmaccal1
Real Oakwood Honors Bio ContestCLOSED09/17/1509/30/15elightrake4
Recipe testerCLOSED05/31/1007/01/10Datstandin2
Red Block 2 | The Foldit GamesCLOSED01/30/1402/07/14xXF4T3D_P4R4D0Xx6
Reinhardt Demo stuffCLOSED06/04/1306/18/13ReinhardtScience1
RevDimerCLOSED12/04/1412/05/14Tanamura1
ricg contestCLOSED05/17/1305/18/13RicGray1
ricgtestCLOSED03/18/1303/24/13RicGray0
RodCLOSED10/08/1210/09/12Rodrigo9990
RodrigoCLOSED10/08/1210/16/15Rodrigo9991
Ronny-testCLOSED09/22/1709/30/17ronnygeo1
Rv0500B - small protein from Mycobacterium tuberculosis H37RvCLOSED08/24/1108/10/14rws92
Rv0657c - small protein from Mycobacterium tuberculosis H37RvCLOSED08/23/1108/31/14rws61
SAC Summer 2012 OChem ChallengeCLOSED06/04/1206/10/12brian.parker24
SaLLIa666 GameCLOSED01/08/1401/12/14SaLLIa6661
sampleCLOSED05/08/1205/22/12govstbiochem0
sample 1OPEN01/01/3009/17/19walid.alitani1
SandboxCLOSED10/10/1110/31/12kevinjh1
SandboxCLOSED09/30/1610/02/16CollBio1
SandboxCLOSED10/05/1310/19/13creteen1
Sandbox puzzle for CASP9CLOSED05/02/1005/19/10beta_helix22
Sandbox-40CLOSED12/01/1012/02/10kevinjh1
Sandbox1CLOSED02/03/1202/29/12nlite5101
Sandboxing, private plsCLOSED07/04/1407/04/15Thardus1
sang contesyCLOSED11/30/1312/09/13swl20131
SarNorACLOSED06/12/1207/12/12docsaro1
SAY HI TO ZACHCLOSED10/11/1110/31/11za-za220
SBGCLOSED02/18/1102/19/11crma3
Science aidsCLOSED08/09/1308/12/13sience geek2
Science One Team 10 ProjectCLOSED03/20/1704/01/1706SciOne4
scienceteach test weeCLOSED06/04/1306/18/13ReinhardtScience1
ScienceTeacherTrestingCLOSED06/04/1306/18/13ReinhardtScience0
Script test IIICLOSED08/12/1010/12/10Crashguard3036
Script Test IVCLOSED09/21/1001/31/11Crashguard3031
Script test ligandCLOSED10/20/1001/31/11Crashguard3034
Script tester - DesignCLOSED01/01/3005/24/13Krog1
Script tester 2CLOSED07/04/1007/05/12Krog1
Script tester 3CLOSED07/04/1007/08/11Krog0
Script tester 3CLOSED07/04/1007/08/11Krog1
Script testingCLOSED11/23/1212/31/15Jean-Bob11
scritterTestCLOSED02/15/1302/28/13scritter1
scritterTest2CLOSED02/15/1302/28/13scritter1
SEAL MYOGLOBIN CLOSED04/28/1105/31/11Acida-21
seal myoglobinCLOSED12/01/1012/01/12traywright1
Seal MyoglobinCLOSED03/03/1403/09/14PeerPride0
SEAL MYOGLOBINCLOSED10/23/1010/30/10samwitus0
seal myoglobinCLOSED01/13/1201/31/12sum1
seal myoglobinCLOSED01/13/1201/31/12sum0
SEAL MYOGLOBINCLOSED08/16/1808/31/18Uttkarsh1
SEAL MYOGLOBINCLOSED03/13/1705/11/17srinaldi16561
SEAL MYOGLOBINCLOSED11/23/1101/31/12Ch Garnier14
SEAL MYOGLOBINCLOSED01/02/1101/01/12maksimlekler1
Seal MyoglobinCLOSED11/26/1111/29/11Lelivret1
SEAL MYOGLOBINCLOSED05/25/1211/25/12Ch Garnier19
Second partCLOSED12/10/1212/24/12Placebo1
Serine Proline Rich AfCNACLOSED05/25/1206/28/12cookie20041
SERPINB5CLOSED12/19/1112/26/11Niubilism0
Server models for T0743 ContestCLOSED10/13/1205/13/13Ch Garnier12
SeymoueCLOSED03/16/1503/19/15ChAda20150
sgnerCLOSED04/07/1604/08/16sgner0
sgner1CLOSED04/07/1604/08/16sgner1
sgnerTESTCLOSED04/07/1604/08/16sgner1
SH3PX1CLOSED11/25/1402/28/15Patrick11160
SH3PX1CLOSED11/25/1402/28/15Patrick11160
SH3PX1CLOSED11/25/1402/28/15Patrick11161
SH3PX1CLOSED11/25/1402/28/15Patrick11160
SH3PX1CLOSED11/25/1402/28/15Patrick11160
Sheet Banding TrickCLOSED03/21/1104/30/11itskimo0
SHELLCLOSED08/09/1208/08/13chingsong0
Short BlankCLOSED10/10/1110/31/12kevinjh1
show your proteinCLOSED10/10/1410/30/14Hydromaker1070
SHSCLOSED11/20/1511/21/15fanerdbcshs4
silk proteinCLOSED09/22/1309/13/14danielgcc1
Sim-based Lifecycle EngineeringCLOSED02/29/1203/31/12mxynidis1
Simpler recipe testerCLOSED05/31/1006/30/10Datstandin2
SK III!OPEN12/07/1612/31/19ScratchKid1
SK IVCLOSED12/29/1612/31/15ScratchKid0
SK SKCLOSED09/01/1312/31/16ScratchKid1
SK SKCLOSED09/01/1312/31/16ScratchKid2
SK SK IIOPEN12/04/1612/31/19ScratchKid1
SK VOPEN12/29/1612/31/19ScratchKid1
SK VIOPEN12/29/1612/31/19ScratchKid1
SK VIICLOSED12/29/1612/31/92ScratchKid1
SK VIIOPEN02/02/1712/31/20ScratchKid1
SKHJGFDRSKLCLOSED11/12/1011/30/10marshin1
slitherCLOSED09/16/1012/31/13missb0
Small DimerCLOSED08/22/1308/29/13spdenne1
Small Hepatitis B Surface Antigen (HBsAg)CLOSED05/07/1305/07/14bigben4461
Small partial Tspan peptideCLOSED12/21/1112/31/11rwarn1
Small PeptidesCLOSED09/27/1411/30/14Batz1
Small test 20 segmentCLOSED12/05/1412/01/15aninweton1
Small test proteinCLOSED09/17/1312/31/13wudoo1
Small test protein 2CLOSED09/17/1312/31/13wudoo1
small test variable lengthCLOSED12/05/1412/05/15aninweton1
SMIM1 CLOSED03/24/1303/31/13gestur3
SMT 1CLOSED12/13/1812/21/18levand.csa1
Solve for TreatmentCLOSED08/30/1309/10/13PirateX122
Some Test ContestCLOSED01/26/1202/05/12Biology-EtcManager2
Sorry, This is testCLOSED06/27/1306/28/13myputer1
SparkyCLOSED01/09/1403/09/14Spark61
Spider SilkCLOSED10/19/1810/31/18icaru-51
Spider silk designCLOSED09/01/1312/31/16Jirachi1
Spielwiese - Freestyle Design (Variable Length)CLOSED12/25/1103/31/12Bithalbierer4
Spielwiese - HIV ProteaseCLOSED12/25/1103/31/12Bithalbierer7
Spielwiese Freestyle Design 40CLOSED12/08/1212/31/13Bithalbierer1
SSTUCLOSED04/23/1904/30/19tretbutanol1
Start of Sumer HIVCLOSED06/19/1306/26/13nerdysib1
STDCLOSED10/01/1512/31/18Smellis0
Stefano FuschettoCLOSED09/30/1407/22/16Stefano Fuschetto0
Stop The HIV ProteaseCLOSED12/28/1212/31/12Evaesion1
Streptococcus pneumoniaeCLOSED12/02/1212/31/12Placebo1
Streptococcus pneumoniae 80CLOSED12/02/1212/31/12Placebo1
stress responsive protein [Porphyromonas gingivalis SJD2]CLOSED12/06/1312/12/14DashaDv1
Structural-BioinformaticsCLOSED04/24/1705/08/17AnnaSophalK9
Sugar Binding PuzzleCLOSED07/24/1207/30/12beta_helix6
supCLOSED07/09/1307/10/13bionano10
Sup'bio02CLOSED04/24/1404/27/14isaa5412
Sup'BioFoldCLOSED07/04/1307/05/13Darksliver4
Supbiotech ACLOSED04/24/1404/25/14ChloeAudrey10
Super EasyCLOSED04/01/1705/03/17AndriiMiller1
Super FreestyleCLOSED03/27/1304/27/13super_Nethergirl1
Super FreestyleCLOSED03/27/1304/27/13super_Nethergirl1
Superkittyhorse proteinsCLOSED09/27/1012/31/10avapenny1
Swaggy FoldingCLOSED12/10/1512/15/15Atsnider0
Symmetric Trimer Design - 80 segsCLOSED03/06/1904/05/19jamiexq3
SymmetryTestCLOSED12/07/1512/08/15Batz1
Target 611 - TestCLOSED08/29/1008/30/10Cyanoia1
Tau Protein (441 residue htau40)CLOSED01/23/1312/31/16jinguluninja1
Tbf1CLOSED02/20/1307/17/13Rivsie1
Team 11 TestCLOSED03/18/1703/19/1750SciOne2
Team 5 ProjectCLOSED03/12/1703/31/1728SciOne5
team 6!!CLOSED03/21/1703/25/1720SciOne5
template contest test 2CLOSED05/07/1805/14/18Seth Cooper0
template contest test 3CLOSED05/07/1805/14/18Seth Cooper0
TestCLOSED11/08/1511/30/15Skulduggery1
testCLOSED04/07/1804/08/18samicheen0
TestCLOSED10/15/1010/16/10Pyrohmstr1
TestCLOSED10/15/1010/23/10Pyrohmstr1
testCLOSED08/09/1208/09/13chingsong0
testCLOSED09/06/1909/06/19rigidBiscuit1
testCLOSED06/24/1906/30/19Seth Cooper0
TestCLOSED03/03/1403/05/14PeerPride1
testCLOSED12/11/1412/12/14Bloch_Party1
testCLOSED02/12/1402/13/14l_like2
TestCLOSED03/03/1403/13/14PeerPride0
testCLOSED12/12/1412/13/14bkoep1
testOPEN05/24/1112/31/19gurch190
TestCLOSED05/12/1305/17/13MurloW1
TestCLOSED07/15/1107/01/12berus1
testCLOSED10/25/1010/31/13centic1
testCLOSED03/03/1503/04/15boltax1
testCLOSED03/07/1703/08/17lhatsk1
testCLOSED05/29/1805/30/18joshmiller0
testCLOSED03/11/1203/12/12RedVenom1
TestCLOSED11/23/1511/24/15crostomily0
testCLOSED09/19/1009/20/10rangerQ1
testCLOSED01/24/1301/01/14sonneys1
testCLOSED10/12/1110/13/11laurenting1
testCLOSED09/27/1406/25/15srettie1
TestCLOSED03/12/1703/14/1728SciOne1
TestCLOSED06/04/1106/11/11Zeljko1
testCLOSED03/13/1203/20/12mk181
testCLOSED01/11/1901/12/19mdziurzynski0
TestCLOSED03/09/1307/20/13mind_hack1
TestCLOSED04/21/1206/14/13paulsen0
testCLOSED07/04/1307/05/13Raphsup4
testCLOSED12/02/1512/03/15seantan0
testCLOSED08/19/1008/20/10beta_helix1
testCLOSED04/16/1204/22/12test_account141
testCLOSED10/01/1410/01/15Orcus1
testCLOSED08/13/1508/14/15sungwon1
TestCLOSED08/21/1008/23/10Acida-21
TESTCLOSED06/14/1106/18/11csac19592
TestCLOSED08/12/1408/13/14antoine7771
testCLOSED04/30/1905/01/19charlottemason0
testCLOSED07/12/1607/13/16guolab1
TestCLOSED01/01/3004/30/19charlottemason0
testCLOSED08/19/1308/21/13bkoep1
testCLOSED09/01/1809/02/18peterwashington1
testCLOSED06/22/1807/16/18Bruno Kestemont0
testCLOSED01/05/1101/06/11omelet bob1
testCLOSED01/05/1101/06/11omelet bob1
TestCLOSED01/06/1101/13/11Roedl1
testCLOSED04/25/1404/26/14kasper421
testCLOSED01/12/1801/24/18Uttkarsh1
TestCLOSED06/15/1206/16/12xDust0
TestCLOSED12/03/1612/04/16Justine181
TestCLOSED07/28/1307/31/13violinist670
testCLOSED07/07/1807/31/18tyler09111
testCLOSED01/12/1201/31/12gurimmer0
testCLOSED01/12/1201/31/12gurimmer1
testCLOSED07/13/1807/14/18qk90311
testCLOSED02/10/1502/10/16silverberg3
testCLOSED05/16/1805/17/18customposter1
TestCLOSED10/14/1610/16/16immac6361
test -2CLOSED08/19/1808/31/18qk90311
test 1CLOSED09/23/1510/31/15honeypiebeatles1
test 1CLOSED08/19/1809/16/18qk90311
test 1CLOSED10/20/1710/31/17cxlpku1
test 1CLOSED09/27/1609/29/16ionickiwi1
test 1111CLOSED05/15/1512/31/15cyj1013660
Test 123CLOSED12/07/1212/14/12RicGray1
Test 2CLOSED03/25/1304/30/13RicGray0
test 2CLOSED11/09/1512/25/15Skulduggery1
test 2OPEN05/24/1112/31/29gurch1
Test 327CLOSED03/27/1403/28/14NickyCGS1
Test 3V1ACLOSED03/02/1705/02/17Scopper1
Test 42514CLOSED04/25/1404/26/14NickyCGS1
Test 611CLOSED12/27/1312/28/13NickyCGS1
test 80 segment CLOSED11/23/1411/26/15brgreening1
test 80 trimer 327CLOSED03/27/1403/28/14NickyCGS2
test abetaCLOSED05/16/1405/17/14Seth Cooper1
test abeta 2CLOSED05/16/1405/17/14Seth Cooper1
Test areaCLOSED06/24/1012/31/10mat7471
Test area - HIV proteaseCLOSED06/24/1012/31/10mat7471
test arlaCLOSED02/07/1402/14/14arlap1
test arla 2CLOSED02/07/1402/14/14arlap1
test arla 3CLOSED02/07/1402/14/14arlap0
test asdfgCLOSED07/31/1208/02/12Asbiorn0
Test autoCLOSED04/11/1504/12/15wudoo0
test contestCLOSED02/05/1802/08/18samicheen1
Test contestCLOSED11/23/1511/24/15seantan1
Test ContestCLOSED11/06/1301/31/14Roukess1
Test contestCLOSED02/14/1402/15/14NickyCGS1
test contestCLOSED02/07/1702/28/17brbfold1
Test contestCLOSED02/23/1202/23/13f1pokerspeed1
Test Contest - MLCLOSED05/01/1608/31/16MrMark20143
test contest 04CLOSED01/13/1801/31/18josh041
Test Contest 327CLOSED03/27/1403/28/14NickyCGS1
Test contest for a project at TU ClausthalCLOSED06/20/1506/21/18Shanschke1
Test Contest for LornaCLOSED02/17/1702/19/17dsilva.l1
Test custom contestCLOSED02/06/1802/11/18samicheen1
Test Custom Contest - dev03CLOSED10/09/1710/12/17ronnygeo1
Test DANIELLECLOSED10/04/1510/17/15petetrig1
test descriptionCLOSED04/16/1804/17/18samicheen0
Test designCLOSED05/29/1405/30/14Valectar1
test dimerCLOSED09/03/1309/06/13jsorr1
Test DimerCLOSED06/30/1407/28/14jflat061
Test FDVLCLOSED05/21/1806/20/18Madde1
Test field 1CLOSED06/01/1206/02/12phi161
test for josh03CLOSED01/15/1801/22/18josh031
test for M-SBVfCTCLOSED10/12/1210/13/12tjbertram0
test frizzledCLOSED05/16/1405/17/14Seth Cooper1
test nanogCLOSED05/16/1405/17/14Seth Cooper1
test nanogCLOSED06/17/1406/18/14test_account11
test of SmfT0743fCTCLOSED10/12/1210/13/12tjbertram0
test pdbCLOSED05/24/1805/25/18samicheen1
test pdbCLOSED05/30/1805/31/18samicheen1
Test Post Please IgnoreCLOSED11/24/1411/25/14rjking010
Test ProteinCLOSED06/12/1206/12/13kurenan1
Test ProteinCLOSED12/26/1103/31/12kurenan1
test puzzleCLOSED05/24/1805/25/18samicheen1
Test PuzzleCLOSED12/18/1112/19/11kurenan1
test puzzle newCLOSED05/24/1805/25/18samicheen1
Test Puzzle to Fix ClientCLOSED02/08/1202/29/12beta_helix23
test puzzle uncheckCLOSED05/24/1805/25/18samicheen0
Test Range- HIV LabCLOSED09/01/1009/05/10buddy10181
Test Scripting - ZKoraCLOSED11/08/1211/30/12ZKora1
test templateCLOSED05/04/1805/05/18samicheen0
Test testCLOSED01/06/1201/13/12smfuchs1
test testCLOSED11/08/1411/30/14obiwan0
test testCLOSED11/10/1411/30/14obiwan0
test testCLOSED05/29/1005/30/10CharlieFortsConscience1
test testCLOSED05/19/1205/20/12Stolaf1
test test 12345CLOSED06/04/1406/05/14Seth Cooper0
test titleCLOSED04/20/1804/27/18Seth Cooper0
Test TrimerCLOSED06/30/1407/28/14jflat061
TEST UofGuelph iGEM 2018 oxITCLOSED05/21/1806/20/18RestrictionEndoNykolease3
Test your PC powerCLOSED12/03/1309/30/16Bruno Kestemont59
Test, festyn bibsCLOSED05/15/1405/19/14Behoston2
test-40OPEN09/07/1910/02/19fosfotrinucleotide1
test-contestCLOSED02/01/1202/02/12climax1411
test-custom1CLOSED10/15/1810/21/18Seth Cooper0
test-custom16CLOSED10/01/1810/07/18Seth Cooper0
test-custom17CLOSED10/01/1810/07/18Seth Cooper0
test-custom19CLOSED10/01/1810/07/18Seth Cooper1
test-custom2CLOSED10/15/1810/22/18Seth Cooper1
test-custom20CLOSED10/01/1810/07/18Seth Cooper1
test-custom21CLOSED10/01/1810/07/18Seth Cooper1
test-custom21CLOSED10/01/1810/07/18Seth Cooper1
test-tintin-hivCLOSED11/22/1611/23/16tintin13431
test00CLOSED09/29/1109/30/11spacevet1
test071CLOSED10/07/1110/09/11b3au0711
test1CLOSED05/16/1805/17/18customposter1
test100CLOSED06/10/1406/11/14Seth Cooper1
Test1212CLOSED02/14/1402/15/14NickyCGS1
test123CLOSED11/07/1711/08/17horowsah1
Test1313CLOSED02/14/1402/15/14NickyCGS1
test150CLOSED06/10/1406/11/14Seth Cooper1
test17CLOSED01/09/1801/10/18horowsah1
test17CLOSED04/03/1804/04/18horowsah0
test17CLOSED04/05/1804/06/18horowsah1
test18CLOSED01/09/1801/10/18horowsah1
test18CLOSED04/03/1804/04/18horowsah0
test18CLOSED04/05/1804/06/18horowsah1
test19CLOSED01/09/1801/10/18horowsah1
test19CLOSED04/05/1804/06/18horowsah1
test2CLOSED05/22/1805/31/18customposter1
Test2CLOSED07/15/1107/17/11berus1
Test2CLOSED03/12/1703/19/1728SciOne1
Test2 CLOSED06/10/1106/17/11Zeljko0
test2CLOSED11/06/1301/31/14Roukess1
Test2CLOSED02/23/1202/23/139ct291
test2CLOSED05/16/1805/17/18customposter1
test20CLOSED04/11/1804/12/18horowsah0
test20CLOSED03/20/1403/20/17Jean-Bob1
test20CLOSED01/09/1801/10/18horowsah1
test200CLOSED06/10/1406/11/14Seth Cooper1
test21CLOSED01/09/1801/10/18horowsah1
test22CLOSED01/09/1801/10/18horowsah1
test23CLOSED01/09/1801/10/18horowsah1
test3CLOSED05/22/1805/31/18customposter1
test30CLOSED04/16/1804/17/18horowsah1
test31CLOSED04/18/1804/19/18horowsah0
test32CLOSED04/23/1804/24/18horowsah1
test32CLOSED04/26/1804/27/18horowsah1
Test32714CLOSED03/27/1403/28/14NickyCGS1
test33CLOSED05/01/1805/02/18horowsah1
test34CLOSED05/03/1805/05/18horowsah1
test35CLOSED05/03/1805/04/18horowsah0
test35CLOSED05/06/1805/07/18horowsah1
test36444CLOSED05/06/1805/07/18horowsah1
test40CLOSED09/26/1809/27/18horowsah2
test46CLOSED10/08/1810/09/18horowsah2
test46CLOSED10/03/1810/06/18horowsah1
test47CLOSED10/08/1810/09/18horowsah1
test48CLOSED10/08/1810/09/18horowsah1
test49CLOSED10/08/1810/09/18horowsah1
test50CLOSED10/08/1810/09/18horowsah1
test50CLOSED10/14/1810/15/18horowsah1
test51CLOSED10/08/1810/09/18customposter1
test9CLOSED12/29/1712/30/17horowsah1
testA1CLOSED08/24/1708/25/17ksz1
TestacularCLOSED02/22/1503/30/15HerobrinesArmy0
testbCLOSED12/17/1812/18/18horowsah1
testbibsCLOSED01/16/1801/17/18Addreoran1
testcol4a3bpCLOSED07/18/1312/19/13G_H_B0
testcol4a3bp2CLOSED07/18/1312/19/13G_H_B1
testCommCLOSED07/22/1708/20/17dsilva.l2
TestdudetestCLOSED01/31/1202/29/12testdudetest1
TesteCLOSED02/25/1602/12/19NotEvenTryingM81
testedCLOSED07/19/1907/20/19horowsah1
testerCLOSED06/01/1206/02/12CharlieFortsConscience2
testingCLOSED10/31/1411/01/14ipcfg1
Testing CLOSED08/23/1709/21/17Dr.Chi0
testingCLOSED12/04/1512/08/15vkalas1
Testing 150CLOSED03/09/1503/27/15HerobrinesArmy1
testing Foldit minimize split intein 3NZMCLOSED01/02/1401/02/16sagearbor2
Testing ground 3CLOSED12/30/1312/30/14slofgren1
Testing Group ContestsCLOSED01/09/1301/10/13auntdeen0
testing own scriptCLOSED05/13/1312/31/16Morus1
Testing PuzzleCLOSED01/15/1301/31/13thoyt20121
Testing puzzleCLOSED06/03/1210/03/12Ch Garnier6
testing the contestCLOSED04/15/1005/15/10mat7473
Testing200CLOSED05/30/1405/31/14NickyCGS1
Testmarch2714CLOSED03/27/1403/28/14NickyCGS1
testmbCLOSED02/10/1502/12/15jakelmer1
testtCLOSED06/06/1806/07/18horowsah1
test_contest_resiefilterCLOSED08/30/1809/06/18bkoep1
test_contest_rmsdfilterCLOSED08/30/1809/06/18bkoep1
test_edit2CLOSED05/06/1805/13/18bkoep1
test_fetch_cleared_cacheCLOSED08/30/1809/06/18bkoep1
test_fetch_contestCLOSED08/29/1808/31/18bkoep1
test_scoreboardCLOSED05/22/1905/31/19bkoep2
Test_steveBCLOSED12/01/1112/08/11steveB1
textCLOSED06/30/1907/02/19pey1234561
text2CLOSED06/30/1907/02/19pey1234561
TFPCLOSED11/21/1412/31/14chingsong21
TFP200CLOSED11/25/1412/31/14chingsong22
TFS dwewfCLOSED04/03/1204/04/12jperoff2
The AS challengeCLOSED03/31/1104/17/11AgentScience0
The Beginner contestCLOSED06/24/1006/30/10Gebauer1
the contestCLOSED10/21/1110/28/11Mozzi4
The coolest in 5212CLOSED06/29/1807/09/18CarlQAQ1
The Final ModelCLOSED05/15/1305/16/13WheeDhee8
The Fountain of YouthCLOSED03/20/1303/31/16deinfrank0
the fun alotCLOSED08/28/1708/29/17randcvn0
the grand finalCLOSED08/17/1012/31/13cyclic32
the great vacation raceoffCLOSED06/01/1309/30/13shadow3450
the ice dragons playhouseCLOSED02/06/1502/28/15the ice dragon3
The Marathon of Foldit - New ChapterCLOSED02/01/1402/28/17Bruno Kestemont126
The Marathon of Foldit: 611 residues big puzzle chalengeCLOSED12/03/1312/02/16Bruno Kestemont22
The National Protein TestCLOSED08/22/1408/29/14azak20021
THE OCTAGON v2CLOSED02/07/1302/08/13nomatic1
the only tournament here! (for now)CLOSED05/10/1106/10/11shrock2
the proteinCLOSED09/07/1209/26/15river123451
The science is pure scienceCLOSED08/15/1008/21/10Dj-P1
the testing puzzle!CLOSED07/09/1208/31/12drumpeter18yrs9yrs0
The unbreakable LoopsCLOSED05/30/1109/22/11lukis0
TheoredoxinCLOSED01/31/1201/31/14PeptideMuncher1
thiinngyyy catholeCLOSED08/19/1408/31/14aguy770
thingCLOSED03/03/1303/04/13erek1
This freestyle puzzleCLOSED03/18/1204/30/12GirichMS1
This freestyle puzzle has mutable residues and allows you to add or delete residuesCLOSED05/04/1605/06/16zduzgun1
this is a testCLOSED09/13/1809/16/18merlin2v1
ThreadingCLOSED01/06/1101/13/11AmyLia3301
TIM 200CLOSED09/01/1609/09/16Rsteele71
TIM BarrelCLOSED09/01/1609/09/16Rsteele71
TIM Barrel DesignCLOSED08/29/1609/02/16Rsteele71
TIM Barrel DesignCLOSED08/29/1609/02/16Rsteele71
Time to Cure Cancer- Once and For All!CLOSED03/01/1106/01/11tyler091112
tingleiCLOSED03/09/1103/10/11tinglei7110
Tiroler Nacht der ForschungCLOSED04/25/1204/29/12obiwan1
Tiroler Nacht der Forschung 2CLOSED04/25/1204/29/12obiwan1
To have funCLOSED07/29/1107/20/14mayumiao1
Total freedomCLOSED12/09/1312/10/13ahaddad1
Toxic Gluten MoleculeCLOSED07/11/1207/29/12scooper146
Toxic Gluten PeptideCLOSED07/11/1207/29/12scooper146
TPT_test_puzzleCLOSED06/13/1906/20/19bkoep10
TR624CLOSED10/25/1111/06/11beta_helix2
Transmembrane Molecule ModellingCLOSED06/01/1206/30/12Beerwing1
TrestCLOSED03/02/1403/13/14PeerPride1
trialCLOSED05/22/1805/31/18customposter2
TrialCLOSED08/17/1508/20/15OlgaRadchuk1
trialCLOSED02/04/1502/08/15jort1
Trichoplusia ni. Gloverin ProteinCLOSED10/12/1212/31/13ainstein0011
Trimer designCLOSED12/28/1312/28/14arivero1
trimer testCLOSED12/11/1312/31/15syoifczeri1
Triple Helix DNACLOSED10/03/1310/31/15Tovi1
Trm7CLOSED06/14/1206/21/12v0lfg0ng1
TrollFace gamesCLOSED01/12/1701/14/17TrollFace20021
Trp-CageCLOSED04/14/1504/14/18ivalnic1
Truncated human ryanodine receptor 2CLOSED02/21/1105/31/11Fnallerdaller1
Truncated Human Ryanodine Receptor 2 v2CLOSED02/22/1105/29/11Fnallerdaller1
Trying something out :) pardonCLOSED01/31/1202/29/12PeptideMuncher1
Trying to make a Propeller!CLOSED10/08/1310/31/13wisky1
Tspan peptide 2CLOSED03/03/1204/01/12rwarn1
Turma 302 COLTECCLOSED04/09/1804/20/18camiladlopes1
TwelverOPEN02/12/1712/31/20ScratchKid1
Twisting of the protein (v.2)CLOSED01/01/1101/31/11Dj-P5
Twisting of the protein (v1.0)CLOSED12/28/1004/15/11Dj-P11
Two Day Beat Back the Boredom PuzzleCLOSED01/24/1301/26/13auntdeen14
Two symmetric chains, 40 segments each; all can be designed.CLOSED05/03/1605/05/16zduzgun1
UCDS April ContestCLOSED04/01/1304/30/13UCDS_A024
UCDS Test ContestCLOSED03/25/1304/30/13UCDS_Test3
UCSF DNA Challenge CLOSED10/25/1111/06/11beta_helix3
UCSF Intro PuzzleCLOSED10/21/1110/25/11beta_helix21
UNC SHARP Contest 1CLOSED07/12/1307/31/13jetaiken3
UNC SHARP Contest 2CLOSED07/12/1307/31/13Sharp30
UNC SHARP Contest 2CLOSED07/12/1307/31/13jetaiken1
University of Edinburgh Biophysical chemistry workshop 2017CLOSED03/21/1707/01/17jmichel809
Unl. SandboxCLOSED12/02/1012/31/10kevinjh1
Upo CrazyCLOSED04/11/1904/30/19chochito0
UrenaCLOSED01/11/1401/12/14robertito1
USTB workCLOSED10/09/1510/10/15chingsong1
USTB2017CLOSED11/29/1712/29/17chingsong29
USTB2019CLOSED03/11/1904/10/19chingsong51
utacaCLOSED10/25/1311/15/16utaca1
Valentine's dayCLOSED11/06/1302/14/14Compassionate1
vanabinCLOSED10/10/1410/11/14polli81
Vandeweyer_ProteinCLOSED04/22/1304/30/13gvandeweyer1
variable freestlye designCLOSED12/21/1112/31/11sum0
variable freestlye designCLOSED12/21/1112/31/11sum1
Variable Length Protein StructureCLOSED09/29/1612/31/16Atombryan1
Varriable FreestyleCLOSED08/30/1209/30/12Dishrat0060
vgsetgethgtr rgwethgCLOSED02/14/1302/14/16oxyi1
vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyhCLOSED05/18/1105/19/11oxyi1
Viral accessory proteinCLOSED05/03/1605/22/16Zephrin1
virusCLOSED09/02/1212/28/12Aqua8171
Virus MatrixCLOSED07/15/1308/15/13dbuske1
vlp de filetteCLOSED04/23/1405/31/14alexram991
VopXCLOSED09/20/1110/20/11rabidfurball1
vroomCLOSED01/02/1201/28/12kasmol1
vroom2CLOSED02/24/1203/24/12kasmol2
WaiweraCLOSED03/13/1904/12/19Aminal881
We are bored - Design Trimer ContestCLOSED08/02/1508/16/15jamiexq9
Week 5 Camp BIOmedCLOSED08/03/1508/07/15apklock6
WerncsCLOSED12/07/1712/08/17caitlin@newcitycharterschool.org11
What can you do???CLOSED06/25/1806/26/18Carrie_W1
what is this???CLOSED12/02/1312/05/13Niiikola2
Whatever You WantCLOSED12/20/1312/21/13The Super Cat0
Why not, really?CLOSED12/22/1001/22/11anthunk10
Wiggle DesignCLOSED07/02/1907/09/19bkoep2
win or loseCLOSED11/28/1512/01/15spider8760
Wisks ContestCLOSED04/06/1304/30/13WiskIRC2
Wolfer's ClassCLOSED05/31/1206/06/12NTWII4
Wolfer's Class 2CLOSED05/31/1206/06/12NTWII1
working in a mutate scriptCLOSED09/07/1209/01/13BitSpawn1
WSC Bioc 1 F17 ECCLOSED11/03/1711/18/17jcnichols15
WSC Bioc S19CLOSED04/08/1904/22/19jcnichols11
WSC Bioc Spring 2016CLOSED03/25/1604/10/16jcnichols18
WSC Bioc1 S18 ECCLOSED04/02/1804/22/18jcnichols13
WSU Bioc (S13)CLOSED02/18/1302/20/13jcnichols37
WSU Bioc 1 S18CLOSED04/05/1704/23/17jcnichols16
WSU Bioc Fall 16CLOSED10/20/1611/03/16jcnichols2
WSU Fall 16 BiochemistryCLOSED11/02/1611/20/16jcnichols17
WSU Fall 18 EC tempCLOSED11/07/1811/18/18jcnichols1
WSU Fall 2018 EC ContestCLOSED10/31/1811/12/18jcnichols13
WTF! BOOMCLOSED12/01/1712/03/17DomasterPM1
Wulff's Fantastic Core ChallengeCLOSED01/27/1402/28/14-Jacoby-12
ww domainCLOSED01/08/1301/31/13deans2
xCLOSED01/22/1502/18/15jakelmer1
XYCLOSED10/28/1010/29/10PdB241
xz 07 biotechnology CLOSED09/02/1012/31/10xuchenidea0
yahyaCLOSED09/17/1301/13/16yahyamohammed0
Yay!CLOSED11/10/1511/17/15code cat1
ycgECLOSED12/08/1712/11/17cjkunze10
YesCLOSED07/24/1207/25/12JBrown23222
ygkasCLOSED08/13/1308/17/14sotk2
ygkas 1-80CLOSED08/23/1008/23/11sotk1
ygkas1 40-120CLOSED08/26/1008/26/11sotk1
ygkas2CLOSED08/11/1008/11/11sotk0
Ykl071w Amino acid sequenceCLOSED05/09/1105/31/11Dendroid1
YneMCLOSED07/10/1308/17/13canthony91
yoCLOSED10/31/1411/01/14otterballer1
Yo dawgCLOSED11/25/1311/30/13HelloKittyIslandAdventure1
you betta winCLOSED09/19/1209/23/12SOARcmoo1
You choose the number of residuesCLOSED02/11/1502/28/18michaeled31420
yoyoyoCLOSED10/24/1512/03/15Aria Deng2
Yu's lab C2E1CLOSED03/11/1203/01/15lijiahua19841
yuqianhengyuanCLOSED06/26/1706/27/17yuqianhengyuan0
zekromCLOSED09/30/1301/01/14canadajan0
zhustbCLOSED08/26/1208/25/13chingsong1
ZiaCLOSED05/17/1608/27/16Ziauddin Ahmer0
zincfingersCLOSED11/20/1402/18/15chingsong21
zz zzCLOSED12/11/1812/19/18CaoKBiol13001
zzzzzzzzzCLOSED06/10/1006/11/10yjh0
[DEPRECATED] GTPase Ras long run *Anyone can join!*CLOSED01/28/1412/31/15AsDawnBreaks128
все надоемоCLOSED09/24/1209/30/12egik19971
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons