puzzle picture
782: De-novo Freestyle 30: Hand-folding Round
Status: Closed

Summary

Name: 782: De-novo Freestyle 30: Hand-folding Round
Status: Closed
Created: 09/20/2013
Points: 100
Expired: 09/27/2013 - 23:00
Difficulty: Intermediate
Description: We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.
Categories: Hand-Folding, Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders10,234100
2Another Hour Another Point10,20283
3Go Science10,05668
4Void Crushers10,01155
5Anthropic Dreams10,00544

Top Soloists



Need this puzzle? Log in to download.  

Comments

bkoep's picture
User offline. Last seen 1 hour 1 min ago. Offline
Joined: 11/15/2012
Groups: None
Waiting for secondary structure predictions

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep's picture
User offline. Last seen 1 hour 1 min ago. Offline
Joined: 11/15/2012
Groups: None
FASTA Sequence:

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep's picture
User offline. Last seen 1 hour 1 min ago. Offline
Joined: 11/15/2012
Groups: None
SAM secondary structure predictions

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!

Madde's picture
User offline. Last seen 51 weeks 3 days ago. Offline
Joined: 05/29/2008
Groups: Void Crushers
Link to the Jpred3 result of this sequence
Madde's picture
User offline. Last seen 51 weeks 3 days ago. Offline
Joined: 05/29/2008
Groups: Void Crushers
GUI recipe to set the secondary structures according to JPred

http://fold.it/portal/recipe/46925

Edit:
It's pretty much the same as the SAM prediction

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons