Contest Info

Name: SMIM1
Owner: gestur
Start Date: 03/24/13
End Date: 03/31/13
Puzzle: Freestyle Design: Variable Length

The bloodgroup Fel, recently found to be encoded by SMIM1. Extracellular part consisting of MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGK

Registered Contestants

UserScoresort icon

Contest List
Get Started: Download
  Windows    OSX    Linux  
(10.7 or later)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Only search
Recommend Foldit
User login
Top New Users

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons