Contest Info

Name: DSSP algorithm vs NR data base
Owner: BitSpawn
Start Date: 05/29/12
End Date: 06/29/12
Puzzle: Freestyle Design 80
Description:

Very diferent secondary structures for the same sequence.
Seq: AAAATLAAAAVIGAAAAVVLTMSAAACVVLAAAAFESAAAFSFAAAFSVAAAFTPHAAAFVEIAAAGIVSYAAAGKVYAAAGVFAAAIA
SS with a trained DSSP: -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHH--HHHHHH--HHHHHHHHHHHHH--
Anthropic Dreams program: HHHH--EEEEEEEEEEEEEEEEEEEEEEEEEEEE--EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE---EEEEEEEE-


Registered Contestants

UserScoresort icon
jamiexq10099
meatexplosion9352
BitSpawn9297
harp9207
lamoille9121
gmn8861

Registered Groups

Groupsort iconScore
Anthropic Dreams10099



Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons