Contest Info

Name: Cancer Treatment Contest
Owner: DaVinci21
Start Date: 03/24/12
End Date: 04/24/12
Puzzle: Freestyle Design 80
Description:

N-Terminal domain of a protein involved in signal transduction.
It has been associated with cancerous cells but the structure is yet unclear.
Take part in resolving this puzzle.
The Sequence in FASTA format:
MTPSPTKELMSATPTISRRPREEFAEKGAIIREVEDGVRCEQCKSDCPGF
AAHDWRKTCQSCKCPREAHAIYQQQTTNVH


Registered Contestants

UserScoresort icon
DaVinci210





Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons