puzzle picture
2122: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed

Summary

Name: 2122: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed
Created: 03/17/2022
Points: 100
Expired: 03/24/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,177100
2Anthropic Dreams10,17074
3L'Alliance Francophone10,14754
4Marvin's bunch10,12038
5Go Science10,11227

Top Evolvers

RankPlayerGroupScorePoints
1LociOiling 2 1 Beta Folders10,174100
2Galaxie 1 2 Anthropic Dreams10,17096
3phi16 10 31 Anthropic Dreams10,16092
4MicElephant 8 15  10,15388
5guineapig 15 13  10,14984

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 2 1 Beta Folders10,177100
2Sandrix72 18 6  10,17396
3gmn 4 5 Anthropic Dreams10,16792
4Galaxie 1 2 Anthropic Dreams10,15988
5dcrwheeler 46 4  10,15584


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 41 min ago. Offline
Joined: 12/27/2012
eelpout shout out
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons