puzzle picture
2116: Revisiting Puzzle 117: Transport Mutant
Status: Closed

Summary

Name: 2116: Revisiting Puzzle 117: Transport Mutant
Status: Closed
Created: 03/03/2022
Points: 100
Expired: 03/10/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
a MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,780100
2Contenders9,77673
3Go Science9,77152
4Anthropic Dreams9,76736
5L'Alliance Francophone9,76024

Top Evolvers

RankPlayerGroupScorePoints
1LociOiling 2 1 Beta Folders9,777100
2maithra 6 26 Contenders9,77697
3Bruno Kestemont 3 3 Go Science9,76693
4MicElephant 8 15  9,76590
5guineapig 17 14  9,76387

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 5 hours 29 min ago. Offline
Joined: 12/27/2012
imaginary iron
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons