puzzle picture
2095: Revisiting Puzzle 109: Pumpkin
Status: Active

Summary

Name: 2095: Revisiting Puzzle 109: Pumpkin
Status: Active
Created: 01/13/2022
Points: 100
Expires: 01/20/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence:
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,322
2Go Science9,306
3Beta Folders9,279
4Contenders9,199
5L'Alliance Francophone9,183

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
gourdian knot
Vincera's picture
User offline. Last seen 6 hours 18 min ago. Offline
Joined: 02/14/2010
Groups: None
Gordian Knot > TEO Recipe

Greetings, Loci!
Is this the same GK to which you refer?:

Dissolving the Gordian Knot
A ‘druggable’ mechanism of tau protein pathology could lead to new treatment for some of our most devastating neurodegenerative diseases

https://www.news.ucsb.edu/2019/019394/dissolving-gordian-knot

Have you found @CharaLilith's "Tau-Extremal Optimization" recipe (ID 105093) to be useful for the pumpkin puzzle? https://fold.it/portal/recipe/105093

Joined: 12/27/2012
Groups: Beta Folders
these are not the Gords you're looking for...

That tau knot is not a good knot, but I was thinking gourds, not Gords, eh?

I learn something new every day here in Foldit-land. I previously might have thought tauopathy had something to do with taupe, but nope.

What is taupe? Wikipedia as usual has an answer:

The name originally referred only to the average color of the French mole, but beginning in the 1940s, its usage expanded to encompass a wider range of shades.

Glad they could clarify that. I'm still concerned about that mole, even if it is only average.

On Tau-Extremal front, I'm trying the recipe, but I'm still not exactly sure what it does. I was just intimidated by the name.

I've never understood why the pumpkin puzzle has only 44 segments, where the PDB entries have 68. (Or 1TIN has 68, at least.) Seems like a creative approach might be more effective than trying to match a known solution when you have only 66% of the segments.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons