puzzle picture
2075: Revisiting Puzzle 91: Virus Protein
Status: Active

Summary

Name: 2075: Revisiting Puzzle 91: Virus Protein
Status: Active
Created: 11/25/2021
Points: 100
Expires: 12/02/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence:
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,460
2Beta Folders10,456
3Go Science10,309
4Marvin's bunch10,288
5Contenders10,245

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 45 min 20 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
just in case you haven't had enough virus stuff
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons