puzzle picture
2042: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed

Summary

Name: 2042: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed
Created: 09/09/2021
Points: 100
Expired: 09/16/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,735100
2Go Science10,72774
3Beta Folders10,66154
4L'Alliance Francophone10,61438
5Anthropic Dreams10,60627

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Enzyme 70 18 Gargleblasters10,734100
2Phyx 41 22 Go Science10,72597
3sallallami 70 6  10,70794
4LociOiling 4 1 Beta Folders10,66191
5g_b 70 34  10,66088


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 17 min 22 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
ion u
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons