puzzle picture
2036: Revisiting Puzzle 77: Copper Chaperone
Status: Closed

Summary

Name: 2036: Revisiting Puzzle 77: Copper Chaperone
Status: Closed
Created: 08/25/2021
Points: 100
Expired: 09/02/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,383100
2Anthropic Dreams10,38173
3Marvin's bunch10,18452
4L'Alliance Francophone10,10236
5Contenders10,07124

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 4 1 Beta Folders10,377100
2grogar7 38 2 Anthropic Dreams10,37398
3sallallami 70 6  10,29995
4g_b 70 34  10,19992
5fiendish_ghoul 70 16  10,16390


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 9 hours 44 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
a good chap
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons