![]() |
2004: Revisiting Puzzle 67: Integrase
Status: Closed
|
Summary
Name: | 2004: Revisiting Puzzle 67: Integrase |
---|---|
Status: | Closed |
Created: | 06/10/2021 |
Points: | 100 |
Expired: | 06/17/2021 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.