puzzle picture
1970: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed

Summary

Name: 1970: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
Created: 03/18/2021
Points: 100
Expired: 03/25/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,135100
2Anthropic Dreams10,13371
3L'Alliance Francophone10,01549
4Beta Folders10,00933
5Marvin's bunch10,00322

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Galaxie 4 5 Anthropic Dreams10,131100
2g_b 89 16  10,12697
3Phyx 57 41 Go Science10,11794
4ichwilldiesennamen 6 1 Go Science10,10891
5akaaka 89 17  10,10788


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 51 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
T-cell receptor
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons