![]() |
1946: Revisiting Puzzle 52: Bacteria Energy
Status: Closed
|
Summary
Name: | 1946: Revisiting Puzzle 52: Bacteria Energy |
---|---|
Status: | Closed |
Created: | 01/20/2021 |
Points: | 100 |
Expired: | 01/28/2021 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
We're back to the beginning of the revisiting puzzle series.
https://foldit.fandom.com/wiki/Revisiting_puzzle/52:_Bacteria_Energy