|
1928: Revisiting Puzzle 147: Rosetta Decoy 10
Status: Closed
|
Summary
| Name: | 1928: Revisiting Puzzle 147: Rosetta Decoy 10 |
|---|---|
| Status: | Closed |
| Created: | 12/10/2020 |
| Points: | 100 |
| Expired: | 12/17/2020 - 18:00 |
| Difficulty: | Novice |
| Description: | This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/147:_Rosetta_Decoy_10