puzzle picture
1925: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Closed

Summary

Name: 1925: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Closed
Created: 12/02/2020
Points: 100
Expired: 12/10/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence:
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,601100
2Gargleblasters11,58671
3Go Science11,58349
4Beta Folders11,52833
5L'Alliance Francophone11,41622

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Aubade01 89 46  11,621100
2grogar7 54 4 Anthropic Dreams11,60198
3Enzyme 52 3 Gargleblasters11,58695
4ZeroLeak7 17 1 Go Science11,58392
5LociOiling 9 5 Beta Folders11,52889


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 24 min 44 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
decoy
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons