puzzle picture
1922: Revisiting Puzzle 144: Rosetta Decoy 8
Status: Closed

Summary

Name: 1922: Revisiting Puzzle 144: Rosetta Decoy 8
Status: Closed
Created: 11/25/2020
Points: 100
Expired: 12/03/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science12,029100
2Anthropic Dreams12,00973
3L'Alliance Francophone11,97652
4Beta Folders11,97336
5Gargleblasters11,92624

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1dcrwheeler 87 7  12,046100
2ZeroLeak7 29 17 Go Science12,02998
3drjr 87 105 Anthropic Dreams12,00995
4guineapig 87 51  12,00292
5grogar7 44 2 Anthropic Dreams12,00189


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 22 min 33 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the throwback machine
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons