puzzle picture
1919: Revisiting Puzzle 143: Rosetta Decoy 7
Status: Closed

Summary

Name: 1919: Revisiting Puzzle 143: Rosetta Decoy 7
Status: Closed
Created: 11/18/2020
Points: 100
Expired: 11/26/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,848100
2Anthropic Dreams9,83774
3Go Science9,74354
4Contenders9,69738
5L'Alliance Francophone9,69427

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 17 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
two decoys running
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons