puzzle picture
1917: Revisiting Puzzle 142: Rosetta Decoy 6
Status: Closed

Summary

Name: 1917: Revisiting Puzzle 142: Rosetta Decoy 6
Status: Closed
Created: 11/12/2020
Points: 100
Expired: 11/20/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence:
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders12,044100
2Go Science12,00076
3L'Alliance Francophone11,98356
4Anthropic Dreams11,93341
5Contenders11,90529

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 6 1 Beta Folders12,035100
2ZeroLeak7 44 9 Go Science12,00097
3aznarog 102 71 L'Alliance Francophone11,98394
4g_b 102 13  11,96391
5mirp 1 3 Go Science11,95988


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 7 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
for the bafflement of all
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons