puzzle picture
1914: Revisiting Puzzle 141: Rosetta Decoy 5
Status: Closed

Summary

Name: 1914: Revisiting Puzzle 141: Rosetta Decoy 5
Status: Closed
Created: 11/06/2020
Points: 100
Expired: 11/13/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,908100
2Go Science11,83471
3Anthropic Dreams11,79149
4Marvin's bunch11,70633
5Gargleblasters11,68922

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 6 1 Beta Folders11,908100
2ZeroLeak7 44 9 Go Science11,80297
3drjr 86 87 Anthropic Dreams11,79194
4MicElephant 50 43  11,77492
5guineapig 102 61  11,76889


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 6 hours 50 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
before I forget

https://foldit.fandom.com/wiki/Revisiting_puzzle/141:_Rosetta_Decoy_5

The wiki has a page for each of the revisiting puzzles.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons