puzzle picture
1890: Revisiting Puzzle 136: Cell Adhesion
Status: Closed

Summary

Name: 1890: Revisiting Puzzle 136: Cell Adhesion
Status: Closed
Created: 09/11/2020
Points: 100
Expired: 09/18/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,957100
2Anthropic Dreams9,87074
3Beta Folders9,86454
4Gargleblasters9,81238
5Void Crushers9,76427

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Bruno Kestemont 2 3 Go Science9,950100
2MicElephant 74 47  9,89897
3NinjaGreg 29 11 Go Science9,89494
4mirp 1 1 Go Science9,88591
5Aubade01 113 61  9,87188


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 19 min 21 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
been so long...
spmm's picture
User offline. Last seen 6 days 12 hours ago. Offline
Joined: 08/05/2010
Groups: Void Crushers
Seg 25 locked in place?

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep's picture
User offline. Last seen 20 hours 29 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Details?

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons