puzzle picture
1887: Refinement Target: R1091
Status: Closed

Summary

Name: 1887: Refinement Target: R1091
Status: Closed
Created: 09/04/2020
Points: 100
Expired: 09/11/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,108100
2Gargleblasters11,04768
3Beta Folders11,03244
4Anthropic Dreams10,98827
5Contenders10,94916

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons