![]() |
1878: Refinement Puzzle: R1034
Status: Closed
|
Summary
Name: | 1878: Refinement Puzzle: R1034 |
---|---|
Status: | Closed |
Created: | 08/13/2020 |
Points: | 100 |
Expired: | 08/21/2020 - 18:00 |
Difficulty: | Novice |
Description: | CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!
Sequence:
LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.