puzzle picture
1875: Refinement Puzzle: R1055
Status: Closed

Summary

Name: 1875: Refinement Puzzle: R1055
Status: Closed
Created: 08/07/2020
Points: 100
Expired: 08/14/2020 - 23:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,553100
2Beta Folders11,49473
3L'Alliance Francophone11,48852
4Go Science11,46436
5Contenders11,43824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons