puzzle picture
1869: Refinement Puzzle: R1049
Status: Closed

Summary

Name: 1869: Refinement Puzzle: R1049
Status: Closed
Created: 07/24/2020
Points: 100
Expired: 07/31/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,477100
2Go Science11,39277
3Anthropic Dreams11,30258
4L'Alliance Francophone11,18543
5Marvin's bunch11,13131

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 4 1 Beta Folders11,477100
2malphis 68 1814  11,38798
3Aubade01 68 46  11,34295
4ZeroLeak7 68 96 Go Science11,31392
5Phyx 37 24 Go Science11,26689


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons