Summary

Name:	1860: Refinement Puzzle: R1040
Status:	Closed
Created:	07/02/2020
Points:	100
Expired:	07/10/2020 - 18:00
Difficulty:	Intermediate
Description:	THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts! Sequence: PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	11,867	100
2	Beta Folders	11,851	77
3	L'Alliance Francophone	11,767	58
4	Anthropic Dreams	11,729	43
5	Contenders	11,675	31

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	NinjaGreg 23 9	Go Science	11,867	100
2	mirp 1 2	Go Science	11,865	98
3	Bruno Kestemont 2 3	Go Science	11,863	95
4	Xartos 22 6	Go Science	11,863	93
5	puxatudo 10 202	Go Science	11,862	90

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	Bruno Kestemont 2 3	Go Science	11,858	100
2	mirp 1 2	Go Science	11,841	98
3	LociOiling 7 1	Beta Folders	11,838	95
4	christioanchauvin 117 41	L'Alliance Francophone	11,767	93
5	Xartos 22 6	Go Science	11,761	90

Show all >

Need this puzzle? Log in to download.

Comments

Sat, 07/04/2020 - 16:59

puxatudo 10 202

Offline

Joined: 04/07/2014

Groups: Go Science

PSIPRED Info

Loads of information here. I hope it's useful.
Server from "UCL Department of Computer Science: Bioinformatics Group"
(http://bioinf.cs.ucl.ac.uk/psipred/)

R1040

http://bioinf.cs.ucl.ac.uk/psipred/&uuid=5d5117c2-be13-11ea-8813-00163e100d53

Mon, 07/06/2020 - 16:57

beta_helix 152 13858

Offline

Joined: 05/09/2008

Groups: None

Thanks, but beware!

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Other Games: Mozak


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	A G-quadruplex-binding macrodomain within the “SARS-unique domain” is essential for the activity of the SARS-coronavirus replica Two-amino acids change in the nsp4 of SARS coronavirus abolishes viral replication Centre d’information sur le nouveau coronavirus Good late game recipes? GPT-3 and LUA


	Top New Users essemiyagi equilibria HelixHealer91 psyi Denon14

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons