|
1860: Refinement Puzzle: R1040
Status: Closed
|
Summary
Name: |
1860: Refinement Puzzle: R1040 |
Status: |
Closed |
Created: |
07/02/2020 |
Points: |
100 |
Expired: |
07/10/2020 - 18:00 |
Difficulty: |
Intermediate |
Description: |
THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures.
CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!
Sequence:
PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
Loads of information here. I hope it's useful.
Server from "UCL Department of Computer Science: Bioinformatics Group"
(http://bioinf.cs.ucl.ac.uk/psipred/)
R1040
http://bioinf.cs.ucl.ac.uk/psipred/&uuid=5d5117c2-be13-11ea-8813-00163e100d53