Summary

Name:	1860: Refinement Puzzle: R1040
Status:	Closed
Created:	07/02/2020
Points:	100
Expired:	07/10/2020 - 18:00
Difficulty:	Intermediate
Description:	THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts! Sequence: PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	11,867	100
2	Beta Folders	11,851	77
3	L'Alliance Francophone	11,767	58
4	Anthropic Dreams	11,729	43
5	Contenders	11,675	31

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	NinjaGreg 33 12	Go Science	11,867	100
2	mirp 1 2	Go Science	11,865	98
3	Bruno Kestemont 2 3	Go Science	11,863	95
4	Xartos 20 22	Go Science	11,863	93
5	puxatudo 27 267	Go Science	11,862	90

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	Bruno Kestemont 2 3	Go Science	11,858	100
2	mirp 1 2	Go Science	11,841	98
3	LociOiling 8 1	Beta Folders	11,838	95
4	christioanchauvin 98 39	L'Alliance Francophone	11,767	93
5	Xartos 20 22	Go Science	11,761	90

Show all >

Need this puzzle? Log in to download.

Comments

Sat, 07/04/2020 - 16:59

puxatudo 27 267

Offline

Joined: 04/07/2014

Groups: Go Science

PSIPRED Info

Loads of information here. I hope it's useful.
Server from "UCL Department of Computer Science: Bioinformatics Group"
(http://bioinf.cs.ucl.ac.uk/psipred/)

R1040

http://bioinf.cs.ucl.ac.uk/psipred/&uuid=5d5117c2-be13-11ea-8813-00163e100d53

Mon, 07/06/2020 - 16:57

beta_helix 102 2632

Offline

Joined: 05/09/2008

Groups: None

Thanks, but beware!

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Social Media


	Search Only search fold.it


	Click here to read Foldit's statement on the Black Lives Matter movement.


	Other Games: Mozak

Recommend Foldit


	Topics
	Create a new experimental script Saving a solution to another computer Office Hours Foldit Newsletters Hats off to our eldest veteran folderers... but...


	Top New Users Alex_Ritchie Lbuettner Zack13 browk107 Vince415

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons