puzzle picture
1857: Refinement Puzzle: R1029
Status: Closed

Summary

Name: 1857: Refinement Puzzle: R1029
Status: Closed
Created: 06/25/2020
Points: 100
Expired: 07/03/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!

Sequence:
MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,568100
2L'Alliance Francophone11,07679
3Anthropic Dreams11,04061
4Contenders11,02347
5Void Crushers10,97235

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons