puzzle picture
1857: Refinement Puzzle: R1029
Status: Closed

Summary

Name: 1857: Refinement Puzzle: R1029
Status: Closed
Created: 06/25/2020
Points: 100
Expired: 07/03/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!

Sequence:
MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,568100
2L'Alliance Francophone11,07679
3Anthropic Dreams11,04061
4Contenders11,02347
5Void Crushers10,97235

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons