puzzle picture
1845: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed

Summary

Name: 1845: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed
Created: 05/28/2020
Points: 100
Expired: 06/05/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,241100
2Contenders10,20774
3Anthropic Dreams10,18454
4Beta Folders10,16238
5L'Alliance Francophone10,12527

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 39 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
fish on ice
Joined: 06/15/2020
Groups: None
Grateful

Thank you so much for the additional information.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons