puzzle picture
1842: Revisiting Puzzle 124: PDZ Domain
Status: Closed

Summary

Name: 1842: Revisiting Puzzle 124: PDZ Domain
Status: Closed
Created: 05/21/2020
Points: 100
Expired: 05/29/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,977100
2Anthropic Dreams10,97674
3Contenders10,97154
4Gargleblasters10,95738
5Beta Folders10,88827

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 24 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
PDZ, PDQ
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons