![]() |
1839: Revisiting Puzzle 117: Transport Mutant
Status: Closed
|
Summary
Name: | 1839: Revisiting Puzzle 117: Transport Mutant |
---|---|
Status: | Closed |
Created: | 05/14/2020 |
Points: | 100 |
Expired: | 05/22/2020 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence: a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/117:_Transport_Mutant