puzzle picture
1839: Revisiting Puzzle 117: Transport Mutant
Status: Closed

Summary

Name: 1839: Revisiting Puzzle 117: Transport Mutant
Status: Closed
Created: 05/14/2020
Points: 100
Expired: 05/22/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
a MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,765100
2Anthropic Dreams9,76480
3Beta Folders9,76463
4Team India9,76349
5L'Alliance Francophone9,74237

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 6 hours 31 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Mutatis mutandis
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons