puzzle picture
1833: Revisiting Puzzle 114: Black Mamba
Status: Closed

Summary

Name: 1833: Revisiting Puzzle 114: Black Mamba
Status: Closed
Created: 04/30/2020
Points: 100
Expired: 05/08/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,271100
2Beta Folders11,25681
3Anthropic Dreams11,24864
4L'Alliance Francophone11,21850
5Gargleblasters11,20939

Top Evolvers

RankPlayerGroupScorePoints
1Dhalion 12 88 Go Science11,271100
2Czim 17 157 Go Science11,26899
3ZeroLeak7 35 6 Go Science11,26697
4mirp 1 3 Go Science11,26595
5RockOn 39 147 Go Science11,26594

Top Soloists



Need this puzzle? Log in to download.  

Comments

Phyx's picture
User offline. Last seen 5 hours 8 min ago. Offline
Joined: 10/08/2011
Groups: Go Science
Give it a squeeze!
OWM3's picture
User offline. Last seen 16 hours 47 min ago. Offline
Joined: 03/08/2020
Groups: Gargleblasters
This puzzle cause segfaults:

This puzzle cause segfaults: https://fold.it/portal/node/2009631

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons