puzzle picture
1830: Revisiting Puzzle 113: White Birch
Status: Closed

Summary

Name: 1830: Revisiting Puzzle 113: White Birch
Status: Closed
Created: 04/24/2020
Points: 100
Expired: 05/01/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
51Mojo Risin'9,3391
52https://fold.it/portal/Chem445_20209,0391
53Trinity Biology8,8281

Top Evolvers

RankPlayerGroupScorePoints

Top Soloists

RankPlayerGroupScorePoints
51Vman 87 3018 Void Crushers10,48335
52WBarme1234 87 28  10,47134
53allie_heather47 87 3018  10,46934
54neon_fuzz 87 3018 Go Science10,45833
55diamonddays 87 1607  10,45031


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 6 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
gesundheit
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons