puzzle picture
1830: Revisiting Puzzle 113: White Birch
Status: Closed

Summary

Name: 1830: Revisiting Puzzle 113: White Birch
Status: Closed
Created: 04/24/2020
Points: 100
Expired: 05/01/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,885100
2Go Science10,88480
3Beta Folders10,79363
4Void Crushers10,78849
5L'Alliance Francophone10,78237

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 11 hours 40 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
gesundheit
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons