puzzle picture
1826: Coronavirus Trimmed ORF8 Prediction
Status: Closed

Summary

Name: 1826: Coronavirus Trimmed ORF8 Prediction
Status: Closed
Created: 04/16/2020
Points: 100
Expired: 04/23/2020 - 23:00
Difficulty: Novice
Description: This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!

Sequence:
FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,291100
2Anthropic Dreams10,22785
3Hold My Beer10,22571
4Gargleblasters10,21060
5Beta Folders10,17649

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 05/09/2008
Groups: None
Signal peptide prediction:
Xartos's picture
User offline. Last seen 3 hours 43 min ago. Offline
Joined: 05/23/2013
Groups: Go Science
Scoreboard

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list...'

marsfan's picture
User offline. Last seen 2 days 21 hours ago. Offline
Joined: 12/18/2015
Groups: None
I will second this.

I will second this.

Joined: 11/18/2012
Groups: None
Ditto

No scoreboard scores here, either.

marsfan's picture
User offline. Last seen 2 days 21 hours ago. Offline
Joined: 12/18/2015
Groups: None
I just filed a report on the

I just filed a report on the feedback page. Some others in the veteran chat have been having the same issue it seems.
https://fold.it/portal/node/2009488

Joined: 05/09/2008
Groups: None
Thank you for reporting this...

We'll try to figure out what is going on.
Thanks for your patience.

Joined: 09/29/2016
Groups: Gargleblasters
My only though...

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB's picture
User offline. Last seen 3 weeks 2 days ago. Offline
Joined: 03/05/2020
Groups: None
It could be encoding error.

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.

Joined: 09/29/2016
Groups: Gargleblasters
Indeed

That was my exact thinking. I just had never personally encountered one where (seemingly) arbitrary spaces get replaced like that! lol
I've seen apostrophes, line-breaks, special characters (like accented or other language), but can't say I've seen spaces! :D

I'm admittedly curious what DID end up to be the cause, now that it's fixed! heh

Mikisp's picture
User offline. Last seen 4 days 19 hours ago. Offline
Joined: 04/01/2020
Groups: None
Psipred

LLLLLLLEELLLLLLLLLLLLLLLLLLEEEEEEELLLLLLEEEEEEHHHLLLLLLEEEEEELLEEEEEEEEEEELLLLLLLEEEEEEEEELLLLLEEEEEEEEEEL

http://bioinf.cs.ucl.ac.uk/psipred/&psipred_uuid=594ff4f6-8315-11ea-9c66-00163e100d53

Joined: 05/09/2008
Groups: None
We found the scoreboard bug!

Thank you again for reporting it, and for your patience.

LociOiling's picture
User offline. Last seen 5 hours 26 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Not quite fixed...

Client shows I've soared to #1 on 1826, but website shows Steven Pletsch is still in command.

Something is borken.

LociOiling's picture
User offline. Last seen 5 hours 26 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
OK, I guess the ferrets were just busy....

Client scoreboard now seems to match the website.

Joined: 05/09/2008
Groups: None
the drupal gnomes took a while ;-)

Glad it's finally back!

Joined: 09/24/2012
Groups: Go Science
Disulfide bonds

Is it possible that some of the cysteins make disulfide bonds and other not ?

Joined: 05/09/2008
Groups: None
It's always possible...

Unfortunately, we really don't have any additional information about this protein... so we can't be confident one way or another.

I would suggest trying different topologies with and without disulfide bonds.

Joined: 04/22/2020
Groups: None
uhhhh what do i

uhhhh what do i do...................?

Joined: 05/09/2008
Groups: None
start here:
Joined: 03/31/2020
Groups: None
oh my god...

how do these top folders achieve 10000+ points...?

Joined: 11/05/2019
Groups: Foldit Staff
Hi Deconstruct!

Hi there! If you're interested in learning more and getting higher scores, I would suggest joining our discord channel to chat with other players and maybe get some helpful pointers!

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons