LociOiling's picture
User offline. Last seen 1 hour 43 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
squeaking by

It looks like this puzzle has the correct expiration time, the usual 1800 UTC, unlike the last few revisiting puzzles.

https://foldit.fandom.com/wiki/Revisiting_puzzle/94:_Mouse

Serca's picture
User offline. Last seen 17 weeks 4 days ago. Offline
Joined: 02/03/2020
Groups: Go Science
they are different

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Joined: 01/19/2019
Groups: Go Science
Yeah, it should be
LociOiling's picture
User offline. Last seen 1 hour 43 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
oops wrong mouse

Rodent infestation!

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons