1822: Revisiting Puzzle 111: Mouse

Status: Closed

Summary

Name:	1822: Revisiting Puzzle 111: Mouse
Status:	Closed
Created:	04/06/2020
Points:	100
Expired:	04/15/2020 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Sequence: TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	9,904	100
2	Go Science	9,880	82
3	Contenders	9,822	66
4	Herobrine's Army	9,794	53
5	Marvin's bunch	9,768	42

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	Angus 75 1437	Beta Folders	9,898	100
2	LociOiling 2 1	Beta Folders	9,896	99
3	mirp 49 1437	Go Science	9,880	97
4	Czim 75 1437	Go Science	9,876	96
5	w1seguy 75 1437	Go Science	9,871	94

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	LociOiling 2 1	Beta Folders	9,904	100
2	Bruno Kestemont 3 3	Go Science	9,880	99
3	ZeroLeak7 35 34	Go Science	9,836	97
4	Angus 75 1437	Beta Folders	9,835	96
5	mirp 49 1437	Go Science	9,834	94

Show all >

Need this puzzle? Log in to download.

Comments

Wed, 04/08/2020 - 22:11

LociOiling 2 1

Offline

Joined: 12/27/2012

Groups: Anthropic Dreams

squeaking by

It looks like this puzzle has the correct expiration time, the usual 1800 UTC, unlike the last few revisiting puzzles.

https://foldit.fandom.com/wiki/Revisiting_puzzle/94:_Mouse

Fri, 04/10/2020 - 15:01

Serca 75 1437

Offline

Joined: 02/03/2020

Groups: Go Science

they are different

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Sat, 04/11/2020 - 09:00

Artoria2e5 75 1437

Offline

Joined: 01/19/2019

Groups: Go Science

Yeah, it should be

Yeah, it should be https://foldit.fandom.com/wiki/Revisiting_puzzle/111:_Mouse.

Wed, 04/15/2020 - 19:22

LociOiling 2 1

Offline

Joined: 12/27/2012

Groups: Anthropic Dreams

oops wrong mouse

Rodent infestation!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Social Media


	Search Only search fold.it


	Click here to read Foldit's statement on the Black Lives Matter movement.


	Other Games: Mozak

Recommend Foldit


	Topics
	Forums temporarily locked due to spam Happy few Gold players in History Interview with DeepMind's Demis Hassabis timing for "share with scientists"? extend deadline for AlphaFold submissions?


	Top New Users zonaldo953 Camma fracata Zhang Ruichong SaraVenegoni

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons