puzzle picture
1822: Revisiting Puzzle 111: Mouse
Status: Closed

Summary

Name: 1822: Revisiting Puzzle 111: Mouse
Status: Closed
Created: 04/06/2020
Points: 100
Expired: 04/15/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,904100
2Go Science9,88082
3Contenders9,82266
4Herobrine's Army9,79453
5Marvin's bunch9,76842

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 9 hours 22 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
squeaking by

It looks like this puzzle has the correct expiration time, the usual 1800 UTC, unlike the last few revisiting puzzles.

https://foldit.fandom.com/wiki/Revisiting_puzzle/94:_Mouse

Serca's picture
User offline. Last seen 12 weeks 23 hours ago. Offline
Joined: 02/03/2020
Groups: Go Science
they are different

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Joined: 01/19/2019
Groups: Go Science
Yeah, it should be
LociOiling's picture
User offline. Last seen 9 hours 22 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
oops wrong mouse

Rodent infestation!

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons