puzzle picture
1819: Revisiting Puzzle 110: Turkey
Status: Closed

Summary

Name: 1819: Revisiting Puzzle 110: Turkey
Status: Closed
Created: 04/01/2020
Points: 100
Expired: 04/08/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Herobrine's Army10,577100
2Contenders10,57083
3Go Science10,55468
4Beta Folders10,49555
5Hun-Magyar Csapat10,39544

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 5 hours 14 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
More info:

https://foldit.fandom.com/wiki/Revisiting_puzzle/110:_Turkey

Also, for some reason this puzzle lacks "Puzzle 1819" in the title.

Joined: 05/19/2009
Groups: Contenders
Why all-hands before puzzle end ?

Why did this puzzle all of a sudden, unannounced change to all-hands ?

Joined: 09/24/2012
Groups: Go Science
stopped earlier ?

3 hours too early ?

Joined: 04/19/2011
Shouldn't the coronavirus

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19...

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons