![]() |
1816: Revisiting Puzzle 109: Pumpkin
Status: Closed
|
Summary
Name: | 1816: Revisiting Puzzle 109: Pumpkin |
---|---|
Status: | Closed |
Created: | 03/24/2020 |
Points: | 100 |
Expired: | 04/01/2020 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.
Sequence:
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/109:_Pumpkin
Like the previous revisiting puzzle, the expiration time on this one is 5 hours later than normal. It's set to expire at 23:00 UTC/GMT, where revisiting puzzles normally expire at 18:00 UTC/GMT.
Puzzle 1813: Revisiting Puzzle 97: Pig was set up the same way, but actually expired at 18:00 UTC, the customary time.
Don't count on the five extra hours! (Sad experience here.)