puzzle picture
1810: Revisiting Puzzle 96: Collagen
Status: Closed

Summary

Name: 1810: Revisiting Puzzle 96: Collagen
Status: Closed
Created: 03/09/2020
Points: 100
Expired: 03/18/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,222100
2Marvin's bunch10,18681
3Beta Folders10,18564
4L'Alliance Francophone10,12550
5Anthropic Dreams10,09339

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Serca 113 74 Go Science10,222100
2LociOiling 5 3 Beta Folders10,18399
3fiendish_ghoul 127 11  10,15998
4Aubade01 127 57  10,15397
5frood66 125 22 Marvin's bunch10,13595


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 18 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
hey, collagen, man!
jeff101's picture
User offline. Last seen 7 hours 33 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Why no ppg repeats?

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

neilpg628's picture
User offline. Last seen 12 hours 54 min ago. Offline
Joined: 08/01/2019
Groups: None
Collagen

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons