puzzle picture
1804: Revisiting Puzzle 94: Mouse
Status: Closed

Summary

Name: 1804: Revisiting Puzzle 94: Mouse
Status: Closed
Created: 02/24/2020
Points: 100
Expired: 03/04/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence:
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,484100
2Void Crushers10,45973
3Anthropic Dreams10,43052
4Marvin's bunch10,41336
5Beta Folders10,38824
Show all >

Top Evolvers

RankPlayerGroupScorePoints
1mirp 1 8 Go Science10,484100
2Bruno Kestemont 2 7 Go Science10,48497
3silent gene 7 14 Go Science10,48394
4NinjaGreg 18 20 Go Science10,44290
5ZeroLeak7 17 1 Go Science10,43787
Show all >

Top Soloists

RankPlayerGroupScorePoints
1ZeroLeak7 17 1 Go Science10,482100
2Timo van&n... 89 471 Void Crushers10,45997
3Threeoak 89 194 Anthropic Dreams10,43094
4fiendish_ghoul 89 12  10,38890
5Serca 89 2536  10,38087
Show all >


Need this puzzle? Log in to download.  

Comments

Wed, 02/26/2020 - 18:30
#1
frood66 89 47
frood66's picture
User offline. Last seen 8 hours 56 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
Is there a reason why we

Is there a reason why we cannot play this? - it is not listed.

Top
  • 0
Wed, 02/26/2020 - 18:48
#2
frood66 89 47
frood66's picture
User offline. Last seen 8 hours 56 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
one player apparently can -

one player apparently can - the rest of us?

Top
  • 0
Thu, 02/27/2020 - 01:44
#3
NinjaGreg 18 20
NinjaGreg's picture
User offline. Last seen 2 days 2 hours ago. Offline
Joined: 05/21/2010
Groups: Go Science
I jump the gun

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.

Top
  • 0
Thu, 02/27/2020 - 05:17
#4
LociOiling 9 5
LociOiling's picture
User offline. Last seen 41 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
mouse in the house

https://foldit.fandom.com/wiki/Revisiting_puzzle/94:_Mouse

Top
  • 0
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons